Lus10022147 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67623 78 / 5e-18 F-box family protein (.1)
AT2G35280 71 / 4e-16 F-box family protein (.1)
AT1G74875 64 / 5e-13 unknown protein
AT3G30430 57 / 3e-11 F-box family protein (.1)
AT1G14800 44 / 1e-05 Nucleic acid-binding, OB-fold-like protein (.1)
AT1G36030 39 / 0.0001 F-box family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030128 193 / 1e-63 AT1G67623 71 / 2e-14 F-box family protein (.1)
Lus10005844 190 / 1e-63 AT1G67623 76 / 3e-17 F-box family protein (.1)
Lus10037978 184 / 9e-60 AT1G67623 82 / 3e-18 F-box family protein (.1)
Lus10038709 181 / 2e-58 AT1G67623 90 / 3e-21 F-box family protein (.1)
Lus10023768 142 / 8e-45 AT1G74875 66 / 6e-14 unknown protein
Lus10038720 119 / 3e-35 ND 41 / 8e-05
Lus10006434 78 / 4e-18 AT1G67623 61 / 1e-10 F-box family protein (.1)
Lus10030790 68 / 2e-14 AT1G67623 57 / 4e-09 F-box family protein (.1)
Lus10006418 50 / 4e-08 AT1G67340 492 / 1e-174 HCP-like superfamily protein with MYND-type zinc finger (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G008800 131 / 6e-39 AT1G74875 110 / 2e-29 unknown protein
Potri.001G321400 124 / 3e-36 AT1G67623 102 / 6e-26 F-box family protein (.1)
Potri.015G096200 52 / 1e-08 AT1G67340 438 / 3e-154 HCP-like superfamily protein with MYND-type zinc finger (.1)
Potri.012G097600 49 / 2e-07 AT1G67340 436 / 2e-153 HCP-like superfamily protein with MYND-type zinc finger (.1)
PFAM info
Representative CDS sequence
>Lus10022147 pacid=23156280 polypeptide=Lus10022147 locus=Lus10022147.g ID=Lus10022147.BGIv1.0 annot-version=v1.0
ATGGCCCCACCAATCTTGTCCCTTCGCCTTCTCCCTAGAGACATCCTCGTCGACGTCCTTGCCAGGGTAGCTATCACATCCTCCGCTGACCTCTTCAGCG
CGAAATTGACATGCAAGGCCCTGTCAGACGCTTCAGCAGACGACTACGTATACCACCATGTCAAGATCTCCAAAATCCCACATAGGCCTTGGAAGATCAA
CCACCAAACCGTCCTCGATCGGTGCATAACCAGCGGTAACCCTGAGGCTCTATTCTGCCGAGGCATTGTCGAGTTCTTTGGTTTGCTTGAAATTCAGTCA
GGCCTTGCCAATTTAATGTCTGCAGCCCAGTCGGGTCACCTGGAATCAATTTACGTTTGCGGCATCGTGTCGTTGTGCCTTGGCCAAGAATAA
AA sequence
>Lus10022147 pacid=23156280 polypeptide=Lus10022147 locus=Lus10022147.g ID=Lus10022147.BGIv1.0 annot-version=v1.0
MAPPILSLRLLPRDILVDVLARVAITSSADLFSAKLTCKALSDASADDYVYHHVKISKIPHRPWKINHQTVLDRCITSGNPEALFCRGIVEFFGLLEIQS
GLANLMSAAQSGHLESIYVCGIVSLCLGQE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G67623 F-box family protein (.1) Lus10022147 0 1
AT4G01830 ABCB5, PGP5 ATP-binding cassette B5, P-gly... Lus10004529 3.6 1.0000
Lus10022145 4.5 1.0000
AT3G25050 XTH3 xyloglucan endotransglucosylas... Lus10011845 4.5 1.0000
AT3G50440 ATMES10 ARABIDOPSIS THALIANA METHYL ES... Lus10012855 4.7 1.0000
Lus10014487 5.1 1.0000
Lus10011061 5.7 1.0000
Lus10011759 6.2 1.0000
AT1G26420 FAD-binding Berberine family p... Lus10023368 6.9 1.0000
AT1G71160 KCS7 3-ketoacyl-CoA synthase 7 (.1) Lus10020662 7.6 1.0000
AT1G08790 Protein of unknown function (D... Lus10021997 7.7 1.0000

Lus10022147 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.