Plant FIBer expression Database

Lus10022151 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G57950 231 / 6e-77 26S proteasome regulatory subunit, putative (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036267
[exp]
362 / 7e-129 AT5G57950 249 / 6e-84 26S proteasome regulatory subunit, putative (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G184600
[exp]
280 / 3e-96 AT5G57950 284 / 8e-98 26S proteasome regulatory subunit, putative (.1)
PFAM info
Representative CDS sequence
>Lus10022151 pacid=23156277 polypeptide=Lus10022151 locus=Lus10022151.g ID=Lus10022151.BGIv1.0 annot-version=v1.0
ATGGTAGCGACGAACTTGAAATCTGAGACTATGAAGCTGATGGAGAAAAGAAGCGCCATCGAGACGGAGATGGATGCCATCATTCAACGTCTCTCACAGC
CAGGCTGTCCTGGACTTTCCGGCAACCTCGTCGACTCCGAGGGTTTTCCACGGACTGATATAGACATTCCAGTTGTCACAGCAGATAGGCATCGTCTTGC
TGGGCTACGGAATGATCACAAGCAGATTACTAAAATAATAGAGGAGAGCATAGAACTTTTGCATTCAGCAAGACTTGCGCCTAAATTTTCCAACTTAGAA
CATTCAGGTACCAATGAAAGTAACCAAAACTCATCAACCAGCAATGTTGCTTCATCAACAACGGCTGCAGATTCCTCCATTTCCATGGACATAGATGCGT
TCACCAACATACCATTTTCAGTAATTGATGAGATAGCTGATGCATCCCCAACCGCGGAAGATGGTATACAGCTTGGAGATCAAATCATAAAATTTGGCAA
TGTCGAGTATCAAGCTGGTGAAAATCTTCTACAGAAGCTGGCTTCGGAGGCACTGGCCAATCAGAATCGGGCAGTATCGGTGGTAGTACTAAGGCAAGGC
TCCCCAACCAACCTATTCGTGACCCCAAGACAATGGCAAGGCAGAGGCTTATTAGGGTAA
AA sequence
>Lus10022151 pacid=23156277 polypeptide=Lus10022151 locus=Lus10022151.g ID=Lus10022151.BGIv1.0 annot-version=v1.0
MVATNLKSETMKLMEKRSAIETEMDAIIQRLSQPGCPGLSGNLVDSEGFPRTDIDIPVVTADRHRLAGLRNDHKQITKIIEESIELLHSARLAPKFSNLE
HSGTNESNQNSSTSNVASSTTAADSSISMDIDAFTNIPFSVIDEIADASPTAEDGIQLGDQIIKFGNVEYQAGENLLQKLASEALANQNRAVSVVVLRQG
SPTNLFVTPRQWQGRGLLG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G57950 26S proteasome regulatory subu... Lus10022151
[exp]
0 1
AT4G05160 AMP-dependent synthetase and l... Lus10013831
[exp]
3.5 0.7890
AT4G32920 glycine-rich protein (.1.2.3) Lus10000229
[exp]
7.9 0.7367
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Lus10017777
[exp]
9.6 0.7494
AT1G60200 splicing factor PWI domain-con... Lus10030623
[exp]
9.9 0.7510
AT4G16060 unknown protein Lus10016832
[exp]
10.0 0.6998
AT5G58050 GDPDL6, SVL4 Glycerophosphodiester phosphod... Lus10000055
[exp]
11.2 0.7846
AT2G01140 PDE345 PIGMENT DEFECTIVE 345, Aldolas... Lus10013477
[exp]
16.3 0.7153
AT5G05190 Protein of unknown function (D... Lus10030508
[exp]
17.1 0.6747
AT5G58170 GDPDL7, SVL5 Glycerophosphodiester phosphod... Lus10019606
[exp]
18.7 0.7405
AT3G18650 MADS AGL103 AGAMOUS-like 103 (.1) Lus10024347
[exp]
20.2 0.7117

Lus10022151 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.