Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007451 [exp] 132 / 1e-39 ND / Lus10033050 [exp] 113 / 4e-32 ND / Lus10005712 [exp] 101 / 3e-27 ND / Lus10032878 [exp] 101 / 5e-27 ND / Lus10006890 [exp] 93 / 1e-24 ND / Lus10027644 [exp] 93 / 3e-24 ND / Lus10034810 [exp] 85 / 2e-21 ND / Lus10017732 [exp] 87 / 3e-21 ND / Lus10039941 [exp] 76 / 7e-18 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022172 pacid=23156303 polypeptide=Lus10022172 locus=Lus10022172.g ID=Lus10022172.BGIv1.0 annot-version=v1.0 ATGCAGGATTACAGTTGGGAAGGACAGTGGCAAGGTTCCTATGCGCAAGATAACTACAATGAAGATTGGAGTTCTTCACCCAACCAATATTATGAGAGCC AAGGTTCACCAACATACTACCAGCCTAACTATGGAGGAGGACAACAACAATGGAACAACTTTGGAGAGGAATCAGATTCCTATTGGAATCAAGACCACTC ACCACCATCTTTTTTCCAAGACTCGTCACCAACTTTCTACCACCAAAACTACCATGAAGACTATCCTATTCAGATGCTGTCTCAATCTCATGCACCGACT GACAGGAGTTTCGATCCTCATCCAGGCACCACAGATGCTCCATTCGCACGTTCTCCAAATTAG
AA sequence Show only first row Show all	>Lus10022172 pacid=23156303 polypeptide=Lus10022172 locus=Lus10022172.g ID=Lus10022172.BGIv1.0 annot-version=v1.0 MQDYSWEGQWQGSYAQDNYNEDWSSSPNQYYESQGSPTYYQPNYGGGQQQWNNFGEESDSYWNQDHSPPSFFQDSSPTFYHQNYHEDYPIQMLSQSHAPT DRSFDPHPGTTDAPFARSPN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022172 [exp]	0	1
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10000843 [exp]	2.4	1.0000
AT1G18100		MFT, E12A11	MOTHER OF FT AND TFL1, PEBP (p...		Lus10002592 [exp]	3.5	1.0000
					Lus10001326 [exp]	4.5	1.0000
					Lus10014857 [exp]	6.3	1.0000
					Lus10026755 [exp]	7.4	1.0000
AT3G23940			dehydratase family (.1.2)		Lus10043131 [exp]	8.4	1.0000
					Lus10016593 [exp]	8.5	1.0000
AT4G17260			Lactate/malate dehydrogenase f...		Lus10028931 [exp]	8.5	1.0000
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10008511 [exp]	8.8	1.0000
AT2G43610			Chitinase family protein (.1)		Lus10020253 [exp]	9.9	1.0000

Compare expression of checked genes

Lus10022172 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.