Lus10022182 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40400 155 / 1e-44 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G64320 92 / 7e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G64580 91 / 1e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G63130 89 / 5e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G09680 89 / 6e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G03560 89 / 1e-20 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G12775 88 / 1e-20 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G53700 84 / 3e-19 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G63080 84 / 3e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G16710 84 / 4e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013077 309 / 2e-103 AT5G40400 587 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10022262 272 / 3e-93 AT5G40400 248 / 6e-78 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10027914 92 / 5e-22 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10012068 92 / 6e-22 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027916 91 / 1e-21 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10036020 90 / 4e-21 AT5G61990 592 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10006373 84 / 3e-19 AT3G53700 1012 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10012328 84 / 4e-19 AT3G53700 1010 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10038974 84 / 6e-19 AT1G74580 911 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G071600 213 / 2e-66 AT5G40400 634 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G074500 91 / 1e-21 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.014G090400 91 / 1e-21 AT5G28460 637 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G236800 91 / 2e-21 AT5G59900 1071 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G147700 89 / 5e-21 AT2G15630 736 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G032600 89 / 7e-21 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.007G068400 87 / 1e-20 AT3G22470 300 / 8e-96 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G013300 88 / 2e-20 AT3G53700 1092 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.009G105600 88 / 2e-20 AT5G39710 1022 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G034200 87 / 3e-20 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10022182 pacid=23156309 polypeptide=Lus10022182 locus=Lus10022182.g ID=Lus10022182.BGIv1.0 annot-version=v1.0
ATGGTTCACAAAGGTTTTAATCCGGACATGGTGGCGTACAACACTTTAATCTGTGGCTACTGCAAAAAAGGAAGGATTCAGGAGGCCAAGTCATTGCTGT
ATCAGATGATAGGGAACGGAATCTGTGCCGATAGTTTCACTTGTCGAGTTTTGATTCGAGCACATGTGGAAGACGGCAGGTTGATGTCGGCTCTGAATTT
AGCAGTGGAGCTTGGGAGATTTGGTGCATCAATTTCTTGCATTGTTTATGATTATCTAATAGTTTGCCTGTGTGAAGAGGATAAGCCGTTTGCCGCGAAG
AGTCTATTAAAAAGGAAGTGTAAGGATGGTTATAAACCAGATATGCTAATCTACGAAAAACTCATCGAGTCTCTGAGCACAATCAACAGTGTAGCTGATG
CATTGCTTCTCAAGTCTGAGATGATTTGTAAGAATGGGAAACCCCTCAGTGTTATGGCATACAAAGCTCTGATCGCCGGTTTGTGTAGAGCAGTCAGAAG
TGCCGAAGCGGAATCTTTGATCGATTAG
AA sequence
>Lus10022182 pacid=23156309 polypeptide=Lus10022182 locus=Lus10022182.g ID=Lus10022182.BGIv1.0 annot-version=v1.0
MVHKGFNPDMVAYNTLICGYCKKGRIQEAKSLLYQMIGNGICADSFTCRVLIRAHVEDGRLMSALNLAVELGRFGASISCIVYDYLIVCLCEEDKPFAAK
SLLKRKCKDGYKPDMLIYEKLIESLSTINSVADALLLKSEMICKNGKPLSVMAYKALIAGLCRAVRSAEAESLID

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G40400 Pentatricopeptide repeat (PPR)... Lus10022182 0 1
AT3G10520 ATGLB2, ARATHGL... NON-SYMBIOTIC HAEMOGLOBIN 2, A... Lus10038655 7.3 0.6612
AT1G30920 F-box family protein (.1) Lus10006734 9.1 0.6539
AT3G26330 CYP71B37 "cytochrome P450, family 71, s... Lus10033564 11.7 0.6453
AT5G42020 BIP2, BIP luminal binding protein, Heat ... Lus10003202 12.6 0.6221
Lus10004437 13.4 0.6383
AT2G24370 Protein kinase protein with ad... Lus10027593 15.0 0.6383
Lus10039674 16.4 0.6383
AT5G02910 F-box/RNI-like superfamily pro... Lus10000727 17.7 0.6383
Lus10021739 19.0 0.6383
AT1G27190 Leucine-rich repeat protein ki... Lus10010615 19.5 0.5973

Lus10022182 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.