Lus10022190 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06620 323 / 5e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G30830 322 / 9e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G30840 317 / 2e-107 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06640 314 / 5e-107 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT1G06650 308 / 7e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G04350 305 / 6e-103 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59540 300 / 7e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT2G25450 300 / 4e-101 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G43440 296 / 2e-100 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G06645 295 / 6e-99 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040382 418 / 3e-147 AT1G06620 411 / 2e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10040380 409 / 1e-143 AT1G06620 387 / 4e-134 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10023499 402 / 6e-141 AT1G06620 400 / 2e-139 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022189 330 / 9e-113 AT1G06620 418 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022196 314 / 2e-106 AT5G59530 420 / 5e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021203 313 / 3e-106 AT1G06620 416 / 2e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022195 313 / 4e-106 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022191 312 / 1e-105 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027585 311 / 3e-105 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G165400 376 / 7e-131 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G156200 343 / 5e-118 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.010G073166 329 / 2e-112 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073300 320 / 9e-109 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073232 306 / 2e-103 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073100 296 / 2e-99 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.013G045000 281 / 2e-93 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G107500 255 / 8e-83 AT1G03400 302 / 3e-100 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G135800 253 / 2e-82 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G136000 241 / 5e-78 AT1G06620 314 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10022190 pacid=23139450 polypeptide=Lus10022190 locus=Lus10022190.g ID=Lus10022190.BGIv1.0 annot-version=v1.0
ATGGTTAATACCATTTCAGCCGGAACCGGAGCAGATTCTGAGAGGAAGAGCGAACTGAAGGCTTTTGACGACACCAAATCCGGCGTGAAAGGCCTAGTCG
ATGCTGGGATCACACAGCTCCCTCGTATATTCAAGCACGATCCATCCGTAATCAACGAACAACCAGTCACCGATGCAACAAAACTCATACCAGTCATAGA
CATGGGAGGCCTTCCGGCTTCACGTTCAGCTGCAATCGAGAAAGTTCGCGACGCTTGTTCAGAATGGGGGTTCTTTCAGGTAATCAACCACGGAATCCCA
GATTCACTTCTGGAGAGCGCACTCGATGGAATTAGAAAGTTTCACGAGCAGGACAGTGATGCCAAGAAAGACTTGTACACCAGGGACGAGACTAGAAAGG
TCATGTTCAACACCAACTTCGATTTTTACCAAACTTCATCAGCTAATTGGAGGGACTCTCTGTACTGCCTTATGGCTCCTGTCCCTGCACACCCTGACGA
GCTTCCTCCCATTTGCAGGGATGTAGTAATCAACTACTCAAAGGAAGTGATGAAATTGGGGCTAACCATTTTCGAGTTGATGTCGGAAGCTCTCGGATTA
GAACCAAACCACCTCAGACACATGGGATGCAGCGATGGACTGTATATGATAGGTCATTACTACCCAGAATGCCCAGAGCCAGAATCGACACTTGGATTGA
GCAAGCACACGGATAGTGGGTTTCTGACAGTGCTTCTCCAAGACCAAACGGGCGGACTTCAGGTTCTCCACCAAGGCCAATGGGTCGATATTCAACCCAT
CCCTGGATCCTTAGTAGTCAACTTAGGAGACATGTCCCAGGCGAGTTGTTTTAAATTAAAGATTCCATCTTTTGTGATATTAATCGTATCTTGA
AA sequence
>Lus10022190 pacid=23139450 polypeptide=Lus10022190 locus=Lus10022190.g ID=Lus10022190.BGIv1.0 annot-version=v1.0
MVNTISAGTGADSERKSELKAFDDTKSGVKGLVDAGITQLPRIFKHDPSVINEQPVTDATKLIPVIDMGGLPASRSAAIEKVRDACSEWGFFQVINHGIP
DSLLESALDGIRKFHEQDSDAKKDLYTRDETRKVMFNTNFDFYQTSSANWRDSLYCLMAPVPAHPDELPPICRDVVINYSKEVMKLGLTIFELMSEALGL
EPNHLRHMGCSDGLYMIGHYYPECPEPESTLGLSKHTDSGFLTVLLQDQTGGLQVLHQGQWVDIQPIPGSLVVNLGDMSQASCFKLKIPSFVILIVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10022190 0 1
AT2G23450 Protein kinase superfamily pro... Lus10032741 1.4 0.9718
AT1G13195 RING/U-box superfamily protein... Lus10006253 6.9 0.9666
AT5G41810 unknown protein Lus10003901 7.5 0.9693
AT2G39855 unknown protein Lus10004678 8.9 0.9666
AT3G03720 CAT4 cationic amino acid transporte... Lus10005687 8.9 0.9611
AT1G11260 ATSTP1, STP1 sugar transporter 1 (.1) Lus10042516 9.0 0.9677
AT1G56140 Leucine-rich repeat transmembr... Lus10031401 9.2 0.9666
AT2G23450 Protein kinase superfamily pro... Lus10011652 9.8 0.9672
AT4G28560 RIC7 ROP-interactive CRIB motif-con... Lus10008242 10.2 0.9331
AT2G03340 WRKY WRKY3 WRKY DNA-binding protein 3 (.1... Lus10015377 10.3 0.9329

Lus10022190 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.