Lus10022192 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06620 369 / 2e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G03410 350 / 2e-119 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G04350 348 / 2e-119 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06650 348 / 2e-119 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT5G59530 345 / 4e-118 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G43440 342 / 6e-117 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G06645 337 / 9e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59540 335 / 5e-114 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G06640 332 / 9e-113 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT5G43450 325 / 4e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022191 628 / 0 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022195 395 / 2e-137 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022193 394 / 4e-137 AT1G06620 455 / 1e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027586 392 / 2e-136 AT1G06620 449 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027585 392 / 3e-136 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021943 388 / 1e-134 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10037796 382 / 2e-132 AT1G06620 442 / 4e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022415 382 / 2e-132 AT1G06620 432 / 6e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021203 379 / 3e-131 AT1G06620 416 / 2e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G073166 390 / 6e-136 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073300 384 / 4e-133 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073232 381 / 2e-132 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.008G165400 339 / 9e-116 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G156200 333 / 2e-113 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.010G073100 302 / 4e-101 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.017G135800 292 / 7e-97 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G222300 291 / 1e-96 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.002G040700 286 / 8e-95 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.013G045000 282 / 2e-93 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10022192 pacid=23139452 polypeptide=Lus10022192 locus=Lus10022192.g ID=Lus10022192.BGIv1.0 annot-version=v1.0
ATGGCGTCCAGCATGTTGCTGAACTCAGAGACCGACCGGCTCGCACAGCTGAAGGCGTTTGATGCGACCAAGGCCGGAGTGAAAGGGCTGGTTGACGCGG
GAGTGAAAGAAATCCCATCACTCTTCCACACACCACCTCATCTCCTCGACAACAGATCATCGTCATCCGACAAGAAGAACAACTTCACTTTCCCAATCAT
TGACCTCGAAGGTGTGGCCACCGATCCGGTCAAGCGCAAGGAGATCGTTGAGAAAGTCAGGGATGCTTCCGCAACTTGGGGATTTTTCGAAGTTCTCAAC
CATGGTGTCCCTATCAACGTCTTGGAAGAGATGAAATCAGGTGTCAAGAGATTCTACGAGCAAGATCTTGAAGAGAAGAAAGAATTCTTTTTACGTATAT
TCTGCAGGGAGATCCTGATTGAATATTCCAAAGAAATGTTGAACATGGGTTACTTGATCTTTGAGCTTTTGTCGGAGGCTTTAGGCCTTGAACCAAATTA
CTTGAGAAACAAAGAGTGCTTGATGGGACACAACTTTGTGTGTCATTACTACCCACCTTGTCCTCAACCAGACCTTACTTTGGGAGCAAGCAAGCATGCC
GACACTGACTTCATGACCATTCTCTTACAAGATCATGTCGGTGGGTGTTTAGGTCTTTCTCGCGGTGGTCTTCAAGTTCTTCATCAAGATCAGTGGGTTG
ATGTCCCTCCATTGCCTGGATCTTTGGTCATCAACGTCGGAGATCTGTTGCAGTTGATGTCCAATGACAAACTCCTAAGTGTCGAGCATCGGGTTCTCGC
AAATCCCACCACCGGACCTAGGATATCCGTGGCGTGCTTTTTCAGTACCGGTATGCTACCAAATCCTACAAAGTATGAACCCATTAAGGAACTCTTATCC
GAAGACAATCCTGCCAAGTACCGGGCTACTACCGTCTCTGAATATGTCACCTATGTTACTAATAAGGGCCTCGACGGAAAATCTCCTCTCCTCCATTTCA
AACTCTAA
AA sequence
>Lus10022192 pacid=23139452 polypeptide=Lus10022192 locus=Lus10022192.g ID=Lus10022192.BGIv1.0 annot-version=v1.0
MASSMLLNSETDRLAQLKAFDATKAGVKGLVDAGVKEIPSLFHTPPHLLDNRSSSSDKKNNFTFPIIDLEGVATDPVKRKEIVEKVRDASATWGFFEVLN
HGVPINVLEEMKSGVKRFYEQDLEEKKEFFLRIFCREILIEYSKEMLNMGYLIFELLSEALGLEPNYLRNKECLMGHNFVCHYYPPCPQPDLTLGASKHA
DTDFMTILLQDHVGGCLGLSRGGLQVLHQDQWVDVPPLPGSLVINVGDLLQLMSNDKLLSVEHRVLANPTTGPRISVACFFSTGMLPNPTKYEPIKELLS
EDNPAKYRATTVSEYVTYVTNKGLDGKSPLLHFKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G43440 2-oxoglutarate (2OG) and Fe(II... Lus10022192 0 1
AT3G26330 CYP71B37 "cytochrome P450, family 71, s... Lus10033633 1.4 0.9956
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Lus10002357 3.5 0.9944
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10028898 3.9 0.9933
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Lus10025902 4.6 0.9942
AT3G48320 CYP71A21 "cytochrome P450, family 71, s... Lus10019460 4.9 0.9940
AT4G11410 NAD(P)-binding Rossmann-fold s... Lus10031100 9.5 0.9880
AT2G30770 CYP71A13 cytochrome P450, family 71, su... Lus10019459 10.1 0.9882
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10034626 10.2 0.9888
Lus10014508 10.2 0.9919
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10008917 10.6 0.9890

Lus10022192 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.