Lus10022193 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06620 423 / 4e-148 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06650 402 / 1e-139 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G06640 393 / 3e-136 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT2G30840 389 / 1e-134 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59540 385 / 3e-133 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G06645 381 / 1e-131 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G30830 379 / 9e-131 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59530 376 / 9e-130 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G04350 375 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G61400 369 / 7e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027586 712 / 0 AT1G06620 449 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10001103 565 / 0 AT1G06620 427 / 2e-149 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022195 460 / 2e-162 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027585 457 / 2e-161 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022191 455 / 1e-160 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021203 453 / 4e-160 AT1G06620 416 / 2e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021943 451 / 5e-159 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022196 442 / 7e-156 AT5G59530 420 / 5e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022415 442 / 2e-155 AT1G06620 432 / 6e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G073232 461 / 6e-163 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073166 440 / 8e-155 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073300 427 / 2e-149 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.008G165400 373 / 2e-128 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073100 366 / 1e-125 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.011G156200 365 / 3e-125 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.013G045000 331 / 6e-112 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.002G040700 315 / 9e-106 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G222300 313 / 9e-105 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G135800 311 / 4e-104 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10022193 pacid=23139398 polypeptide=Lus10022193 locus=Lus10022193.g ID=Lus10022193.BGIv1.0 annot-version=v1.0
ATGGCAGCTTCGTACGATCGACTCGCGGAGTTGAAATCCTTTGACGAAACCAAAGCAGGGGTCAAAGGACTCGTCGACTCAGGAATCAATCACCTCCCTC
GTATCTTCCACGCGCCGCCTCATCTCCTCGACAACATCCCACCCTCCACCGCCCTTACAACTGATCATCCCGATTTCACCTTCCCGATCATAGACCTGGA
AGGCGGCATAGTCACTCAAATCCAAGATCCAATCAAGCGCCAGGAGATAGTGGATAAAGTCAGGGATGCCTCAAAGCAATCTGGGTTTTTCCAAATCGTC
AACCACGGGATCCCGTTAACCGTCCTTGAAGAAATGAAATCAGGGGTTCGCAGGTTTCACGAGCAGGACGTGGAGCAGAGGCGGAAATTCTACACCCGCG
ATTTCAACGCCAGGATCGTTTACAACAGCAACTTCGACCTCTACACGGCGCCATCGGCTAACTGGAGGGACACCGTATCTTTTAATATGGCTCCAAACCC
TCCTAATCCCGACCAGTTGCCCGCCGTCTGTGATGAAATTGTGGCGGAGTATTCTGGGCAAGTTGCAAAATTGGGGGATTTGTTGTTTGAGTTGCTGTCG
GAAGCTTTGGGTTTAGAATCCAACTGCTTGAAGGATTTGGATTGTGGGAAGGGGATTCAGGTTGTGTGTCATTACTATCCGGCATGTCCTCAGCCTGAGC
TTACACTGGGAGCAACTAAGCATGCTGATAACGACTTCATCACCATTCTTCTACAAGACCATATCGGAGGCCTGCAGGTTCTTCGTCATGGCCAGTGGGT
TGACGTGCCTTCGATACCGGGAGCGTTTGTGATCAATATTGGAGATTTTCTACAGCTGGTTTCGAATGATGAGTTTGTAAGTGTGGAGCACAGAGTAGTA
GCGAATAGCAAGGGGCCGAGAATATCTGTTGCAAGTTTGTTTGGGACTTACCTACATCCGAACCCAAGAAAGTATGGGCCGATCAAGGAGCTGTTATCGA
ACGAGAATCCGCCCAAGTACAGGGAAACTACAACTGCAGAATATGTCATATGTGGAAACAACAAGGGACTTGATGGGACTTCTACTCTGTTGCAGTTCAA
GATCTGA
AA sequence
>Lus10022193 pacid=23139398 polypeptide=Lus10022193 locus=Lus10022193.g ID=Lus10022193.BGIv1.0 annot-version=v1.0
MAASYDRLAELKSFDETKAGVKGLVDSGINHLPRIFHAPPHLLDNIPPSTALTTDHPDFTFPIIDLEGGIVTQIQDPIKRQEIVDKVRDASKQSGFFQIV
NHGIPLTVLEEMKSGVRRFHEQDVEQRRKFYTRDFNARIVYNSNFDLYTAPSANWRDTVSFNMAPNPPNPDQLPAVCDEIVAEYSGQVAKLGDLLFELLS
EALGLESNCLKDLDCGKGIQVVCHYYPACPQPELTLGATKHADNDFITILLQDHIGGLQVLRHGQWVDVPSIPGAFVINIGDFLQLVSNDEFVSVEHRVV
ANSKGPRISVASLFGTYLHPNPRKYGPIKELLSNENPPKYRETTTAEYVICGNNKGLDGTSTLLQFKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10022193 0 1
AT2G05830 NagB/RpiA/CoA transferase-like... Lus10001970 1.0 0.9065
AT1G60710 ATB2 NAD(P)-linked oxidoreductase s... Lus10041272 2.4 0.8926
AT3G61220 SDR1 short-chain dehydrogenase/redu... Lus10014689 4.2 0.8579
AT3G48560 TZP5, IMR1, ALS... TRIAZOLOPYRIMIDINE RESISTANT 5... Lus10029955 4.6 0.8615
AT1G02170 AtMCP1b, ATMC1,... LSD ONE LIKE 3, ARABIDOPSIS TH... Lus10028157 4.9 0.8821
AT5G13810 Glutaredoxin family protein (.... Lus10024164 5.5 0.8852
AT1G07890 ATAPX01, CS1, A... maternal effect embryo arrest ... Lus10015970 6.9 0.8582
AT5G58375 Methyltransferase-related prot... Lus10042227 7.7 0.8640
AT2G30860 GLUTTR, ATGSTF7... glutathione S-transferase PHI ... Lus10020735 8.8 0.8486
AT1G17745 PGDH D-3-phosphoglycerate dehydroge... Lus10037333 9.7 0.8222

Lus10022193 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.