Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43540 66 / 6e-15 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1) AT3G09290 65 / 3e-14 C2H2ZnF TAC1 telomerase activator1 (.1) AT3G53820 59 / 3e-12 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1) AT3G23130 59 / 5e-12 C2H2ZnF FLO10, FON1, SUP SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) AT4G17810 59 / 8e-12 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers superfamily protein (.1) AT2G37740 59 / 1e-11 C2H2ZnF ATZFP10, ZFP10 zinc-finger protein 10 (.1) AT2G42410 59 / 1e-11 C2H2ZnF ATZFP11, ZFP11 zinc finger protein 11 (.1) AT5G06070 58 / 2e-11 C2H2ZnF RAB, RBE RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1) AT3G23140 57 / 4e-11 C2H2ZnF URO UPRIGHT ROSETTE, C2H2 and C2HC zinc fingers superfamily protein (.1) AT5G27880 47 / 1e-07 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021213 [exp] 107 / 8e-31 AT3G09290 73 / 2e-16 telomerase activator1 (.1) Lus10041160 [exp] 74 / 1e-17 AT5G43540 69 / 8e-15 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10021881 [exp] 72 / 5e-17 AT5G43540 67 / 3e-14 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10040767 [exp] 66 / 2e-14 AT3G09290 71 / 5e-15 telomerase activator1 (.1) Lus10033867 [exp] 64 / 6e-14 AT5G43540 65 / 1e-13 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10014755 [exp] 63 / 1e-13 AT5G43540 63 / 5e-13 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10024363 [exp] 61 / 8e-13 AT3G53820 69 / 3e-15 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10021215 [exp] 60 / 7e-12 AT3G23130 102 / 1e-25 SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10030967 [exp] 59 / 1e-11 AT4G17810 112 / 1e-30 C2H2 and C2HC zinc fingers superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G074400 [exp] 71 / 2e-16 AT5G43540 69 / 3e-15 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.008G164100 [exp] 71 / 2e-16 AT5G43540 69 / 3e-15 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.016G101300 [exp] 70 / 3e-16 AT3G53820 92 / 2e-24 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.009G037100 [exp] 67 / 3e-15 AT3G53820 74 / 5e-17 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.006G089301 [exp] 67 / 4e-15 AT3G53820 96 / 1e-25 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.002G041600 [exp] 66 / 1e-14 AT4G17810 65 / 6e-13 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.005G221500 [exp] 66 / 1e-14 AT5G43540 61 / 6e-12 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.002G041700 [exp] 62 / 3e-13 AT2G42410 105 / 3e-28 zinc finger protein 11 (.1) Potri.005G221400 [exp] 61 / 1e-12 AT2G42410 97 / 4e-25 zinc finger protein 11 (.1) Potri.008G059000 [exp] 60 / 7e-12 AT5G06070 99 / 2e-24 RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022204 pacid=23139418 polypeptide=Lus10022204 locus=Lus10022204.g ID=Lus10022204.BGIv1.0 annot-version=v1.0 ATGGCGCCGAAAAAGCAACGCAGCTCATCGGACTCATCCAGCGAAGACACCGTAAACGACACGGTGGTTTCGCTGCCGAAACCCAAACGCTCGTACGAGT GCAGTTTCTGCAAGAGAGGGTTCACCAACGCCCAGGCACTAGGCGGCCACATGAACATCCACCGCCGCGACCGCAAAAAGTCGACAGCTTCTGCCGCCGC CGCCAACGTCCGCCAGCCGGTTGGCCCNNNNNNCCCCCCAGCCGGTTGGCCCCTTCGCCGTTTGGGATGCTCAATATCGCCACTTGTACTTTGA
AA sequence Show only first row Show all	>Lus10022204 pacid=23139418 polypeptide=Lus10022204 locus=Lus10022204.g ID=Lus10022204.BGIv1.0 annot-version=v1.0 MAPKKQRSSSDSSSEDTVNDTVVSLPKPKRSYECSFCKRGFTNAQALGGHMNIHRRDRKKSTASAAAANVRQPVGXXXPPAGWPLRRLGCSISPLVL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09290	C2H2ZnF	TAC1	telomerase activator1 (.1)		Lus10022204 [exp]	0	1
					Lus10010246 [exp]	5.1	0.7846
AT5G53840			F-box/RNI-like/FBD-like domain...		Lus10025675 [exp]	6.9	0.7186
AT1G60400			F-box/RNI-like superfamily pro...		Lus10038935 [exp]	8.0	0.7185
AT5G17430	AP2_ERF	BBM	BABY BOOM, Integrase-type DNA-...		Lus10011303 [exp]	12.6	0.6940
AT4G34880			Amidase family protein (.1)		Lus10002805 [exp]	24.7	0.6501
					Lus10020530 [exp]	28.6	0.6205
AT2G15220			Plant basic secretory protein ...		Lus10026586 [exp]	30.6	0.7105
AT1G69630			F-box/RNI-like superfamily pro...		Lus10031499 [exp]	31.4	0.6415
AT3G26210		CYP71B23	"cytochrome P450, family 71, s...		Lus10017678 [exp]	39.7	0.5781
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10021543 [exp]	45.4	0.6307

Compare expression of checked genes

Lus10022204 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.