Lus10022241 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40390 339 / 2e-111 RS5, SIP1 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
AT4G01970 231 / 7e-70 RS4, ATSTS raffinose synthase 4, stachyose synthase (.1)
AT5G20250 222 / 4e-67 RS6, DIN10 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
AT3G57520 213 / 5e-65 RS2, ATSIP2 raffinose synthase 2, seed imbibition 2 (.1.2.3)
AT1G55740 201 / 2e-59 RS1, ATSIP1 raffinose synthase 1, seed imbibition 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027679 329 / 3e-107 AT5G40390 1040 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Lus10017516 229 / 1e-69 AT5G20250 1145 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
Lus10007537 211 / 1e-62 AT3G57520 1235 / 0.0 raffinose synthase 2, seed imbibition 2 (.1.2.3)
Lus10041370 66 / 8e-13 AT5G40390 71 / 8e-15 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Lus10039946 0 / 1 AT5G40390 123 / 9e-38 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G123400 399 / 9e-135 AT5G40390 1147 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.004G207900 389 / 1e-130 AT5G40390 1145 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.017G036700 389 / 1e-130 AT5G40390 1118 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.T124908 364 / 4e-121 AT5G40390 1055 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.002G193700 234 / 4e-71 AT4G01970 1040 / 0.0 raffinose synthase 4, stachyose synthase (.1)
Potri.014G118400 231 / 8e-70 AT4G01970 1087 / 0.0 raffinose synthase 4, stachyose synthase (.1)
Potri.018G126400 219 / 3e-65 AT5G20250 1218 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
Potri.016G002300 212 / 5e-63 AT3G57520 758 / 0.0 raffinose synthase 2, seed imbibition 2 (.1.2.3)
Potri.006G065700 212 / 7e-63 AT5G20250 1154 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
Potri.011G166700 204 / 3e-60 AT1G55740 1154 / 0.0 raffinose synthase 1, seed imbibition 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF05691 Raffinose_syn Raffinose synthase or seed imbibition protein Sip1
Representative CDS sequence
>Lus10022241 pacid=23139406 polypeptide=Lus10022241 locus=Lus10022241.g ID=Lus10022241.BGIv1.0 annot-version=v1.0
ATGGCTCCAACATCTCCTCGAAGTTACACGACCAAACCAGTTTCAGAAACTAACCAGCCGCCTTCTGCCATCTCCTTAGACGGAACCAATCTCAAGGCCA
ACGGCCACGTCTTCCTCTCAGACGTCCCACACAATATCAAACTCACTCCTTCCCACAAATCAGCATCAGGTGCCTTCCTCGGGTTTGACGCCGACCAAGC
CCTCGACCGCCACGTCATCCCCATCGGAAAGCTCAAGAACCTACGCTTCATGAGCATCTTCCGCTTCAAAGTCTGGTGGACCACTCACTGGGTCGGCTCC
AACGGCCGAGACCTCGAACACGAGACCCAACTCCTCATCCTCGACACCTCATCATCCACGTCATCCCCATCTGCCCACGGTAGGCCCTACGTCCTCCTCC
TCCCTATCTTGGAAGGCCCATTTCGAGCATCCTTCCAGCCTGGACTCAACGACGACGTGGACGTCTGCGTGGAGAGCGGGTCCACAAAGGTCAAAGCCTC
CAGCTTTAACCGGGCGGTCTACATTCACGCTGGAGATGACCCTTTTACCCTCGTCAAGGATGCTATGAAGGTCGTCCGGGCCCACTTGGGGACGTTCAAG
CTCTTGGAGGAGAAGACGCCACCGGGGATTGTGGATAAGTTCGGGTGGTGTACGTGGGACGCATTCTATCTTACGGTCAACCCTCAGGGAATCTGGGAAG
GAGTCAAAGGACTCGTCGACGGAGGATGCCCTCCCGGGATGGTGCTCATCGACGACGGCTGGCAGTCGATAAGCCACGATGAGGATCCGATCACCACTGA
AGGGATGAACGGAGAAACCCCCCCGCCGCAGGGGAGCAGATGCCCTGCCGGCTGTTGA
AA sequence
>Lus10022241 pacid=23139406 polypeptide=Lus10022241 locus=Lus10022241.g ID=Lus10022241.BGIv1.0 annot-version=v1.0
MAPTSPRSYTTKPVSETNQPPSAISLDGTNLKANGHVFLSDVPHNIKLTPSHKSASGAFLGFDADQALDRHVIPIGKLKNLRFMSIFRFKVWWTTHWVGS
NGRDLEHETQLLILDTSSSTSSPSAHGRPYVLLLPILEGPFRASFQPGLNDDVDVCVESGSTKVKASSFNRAVYIHAGDDPFTLVKDAMKVVRAHLGTFK
LLEEKTPPGIVDKFGWCTWDAFYLTVNPQGIWEGVKGLVDGGCPPGMVLIDDGWQSISHDEDPITTEGMNGETPPPQGSRCPAGC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G40390 RS5, SIP1 seed imbibition 1-like, raffin... Lus10022241 0 1
AT5G40390 RS5, SIP1 seed imbibition 1-like, raffin... Lus10022240 2.4 0.7888
AT5G42390 SPP stromal processing peptidase, ... Lus10041263 8.2 0.8213
AT5G50920 CLPC1, CLPC, AT... HEAT SHOCK PROTEIN 93-V, DE-RE... Lus10043198 11.5 0.8241
AT1G01320 Tetratricopeptide repeat (TPR)... Lus10004009 15.5 0.8049
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Lus10032826 23.1 0.7708
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Lus10009173 26.5 0.7534
AT5G42390 SPP stromal processing peptidase, ... Lus10021970 27.6 0.8044
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Lus10032827 28.7 0.7484
AT5G50920 CLPC1, CLPC, AT... HEAT SHOCK PROTEIN 93-V, DE-RE... Lus10032543 30.1 0.8013
AT1G33170 S-adenosyl-L-methionine-depend... Lus10017357 30.4 0.7430

Lus10022241 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.