Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40382 91 / 2e-26 Cytochrome c oxidase subunit Vc family protein (.1) AT5G61310 87 / 1e-24 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) AT2G47380 68 / 4e-17 Cytochrome c oxidase subunit Vc family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008765 [exp] 106 / 2e-32 AT5G40382 92 / 6e-27 Cytochrome c oxidase subunit Vc family protein (.1) Lus10002429 [exp] 89 / 2e-25 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10010008 [exp] 89 / 2e-25 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10001454 [exp] 89 / 2e-25 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10040012 [exp] 86 / 5e-24 AT5G61310 99 / 2e-29 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10025028 [exp] 85 / 5e-24 AT5G61310 99 / 2e-29 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G195901 [exp] 88 / 3e-25 AT5G61310 94 / 2e-27 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Potri.014G120500 [exp] 85 / 5e-24 AT5G61310 103 / 3e-31 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description
Representative CDS sequence Show only first row Show all	>Lus10022249 pacid=23139475 polypeptide=Lus10022249 locus=Lus10022249.g ID=Lus10022249.BGIv1.0 annot-version=v1.0 ATGGCTGGGAAGGTCGCACACGTTGCATACAAAGGTCCGAGTATCATCAAGGAGATTGTATATGGCGTCTCACTGGGACTGGCTGCTGGCTTCCTCTGGA AAATGCACCACTGGAACAACCAGAAACGAACCAGAGAGTTCTATGATCTCCTTGACAAAGGAGCCATCAGCAAGACGACCACCATTAATTAG
AA sequence Show only first row Show all	>Lus10022249 pacid=23139475 polypeptide=Lus10022249 locus=Lus10022249.g ID=Lus10022249.BGIv1.0 annot-version=v1.0 MAGKVAHVAYKGPSIIKEIVYGVSLGLAAGFLWKMHHWNNQKRTREFYDLLDKGAISKTTTIN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G40382			Cytochrome c oxidase subunit V...		Lus10022249 [exp]	0	1
AT4G26110		NAP1;1, ATNAP1;...	ARABIDOPSIS THALIANA NUCLEOSOM...		Lus10026197 [exp]	11.7	0.8210
AT5G37810		NIP4;1, NLM4	NOD26-LIKE MIP 4, NOD26-like i...		Lus10035999 [exp]	14.2	0.7268
AT5G27870			Plant invertase/pectin methyle...		Lus10037489 [exp]	15.9	0.8123
AT2G33530		SCPL46	serine carboxypeptidase-like 4...		Lus10040326 [exp]	24.5	0.8082
					Lus10032472 [exp]	25.8	0.8082
AT2G45010			PLAC8 family protein (.1.2)		Lus10042885 [exp]	26.2	0.8013
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Lus10002775 [exp]	31.4	0.8006
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Lus10011998 [exp]	33.2	0.8002
AT1G15910		FDM1	factor of DNA methylation 1, X...		Lus10040287 [exp]	37.2	0.7998
AT3G56570			SET domain-containing protein ...		Lus10029539 [exp]	40.7	0.7970

Compare expression of checked genes

Lus10022249 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.