Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09790 45 / 2e-06 UBQ8 ubiquitin 8 (.1) AT5G38470 42 / 2e-05 RAD23D RADIATION SENSITIVE23D, Rad23 UV excision repair protein family (.1.2) AT3G52590 40 / 3e-05 HAP4, ERD16, UBQ1, EMB2167 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) AT2G36170 40 / 3e-05 Ubiquitin supergroup;Ribosomal protein L40e (.1) AT1G31340 40 / 5e-05 NEDD8, ATRUB1, RUB1 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1) AT3G62250 40 / 5e-05 UBQ5 ubiquitin 5 (.1) AT2G35635 40 / 6e-05 UBQ7, RUB2 RELATED TO UBIQUITIN 2, ubiquitin 7 (.1) AT4G05050 40 / 6e-05 UBQ11 ubiquitin 11 (.1.2.3.4) AT1G23410 40 / 6e-05 Ribosomal protein S27a / Ubiquitin family protein (.1) AT2G47110 40 / 6e-05 UBQ6 ubiquitin 6 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013082 [exp] 139 / 3e-43 AT1G23410 56 / 3e-12 Ribosomal protein S27a / Ubiquitin family protein (.1) Lus10008873 [exp] 40 / 4e-05 AT3G52590 261 / 5e-92 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Lus10030894 [exp] 40 / 6e-05 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Lus10030595 [exp] 40 / 6e-05 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Lus10018367 [exp] 40 / 0.0001 AT4G05320 452 / 4e-164 polyubiquitin 10 (.1.2.3.4.5.6)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G119700 [exp] 42 / 2e-05 AT5G38470 380 / 3e-131 RADIATION SENSITIVE23D, Rad23 UV excision repair protein family (.1.2) Potri.005G096700 [exp] 41 / 3e-05 AT1G31340 270 / 2e-94 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1) Potri.016G077200 [exp] 40 / 3e-05 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.012G024300 [exp] 40 / 3e-05 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.015G007100 [exp] 40 / 3e-05 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.016G077000 [exp] 40 / 3e-05 AT3G52590 194 / 1e-65 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.010G126200 [exp] 41 / 5e-05 AT5G38470 367 / 1e-125 RADIATION SENSITIVE23D, Rad23 UV excision repair protein family (.1.2) Potri.014G115100 [exp] 40 / 5e-05 AT2G47110 255 / 2e-88 ubiquitin 6 (.1.2) Potri.015G111500 [exp] 40 / 5e-05 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Potri.002G190000 [exp] 40 / 5e-05 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF00240 [flax] [poplar] ubiquitin Ubiquitin family
Representative CDS sequence Show only first row Show all	>Lus10022258 pacid=23139492 polypeptide=Lus10022258 locus=Lus10022258.g ID=Lus10022258.BGIv1.0 annot-version=v1.0 ATGCAGATATTCGTGAATCTTCCATCACAGCAAACCCTAACTCTAGACGCGACGCCTTCGGACACAGTCGCCGACGTCAAATCCGCAATCGAATCCCGCA AAGGAACATCACTGTCTAAAGCAGATGACGACGAGCAGTACTACAGCTTAATCCACGGAGGGAAGCTCCTGGAATACGATAGCCTAACCCTGGATCACTA CGGGATAAGGAATCAATTGGCGACAATCCAAATCCTGCCGAGGCTGCTTGGCGGCGGAGGAGGGAAGAGGAGGAAGAAGAAAGTGTTCAGCACACCGAAG AAGGAGAAGAAGGAGAAAGAGAAGTAG
AA sequence Show only first row Show all	>Lus10022258 pacid=23139492 polypeptide=Lus10022258 locus=Lus10022258.g ID=Lus10022258.BGIv1.0 annot-version=v1.0 MQIFVNLPSQQTLTLDATPSDTVADVKSAIESRKGTSLSKADDDEQYYSLIHGGKLLEYDSLTLDHYGIRNQLATIQILPRLLGGGGGKRRKKKVFSTPK KEKKEKEK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09790		UBQ8	ubiquitin 8 (.1)		Lus10022258 [exp]	0	1
					Lus10019223 [exp]	2.8	0.9898
AT4G16515		RGF6	root meristem growth factor 6,...		Lus10008506 [exp]	3.5	0.9890
					Lus10025807 [exp]	4.5	0.9879
AT1G18400	bHLH	bHLH044, BEE1	BR enhanced expression 1 (.1)		Lus10033562 [exp]	11.1	0.9911
AT3G28857	bHLH	PRE5	Paclobutrazol Resistance 5, ba...		Lus10030490 [exp]	17.1	0.9715
AT4G34770			SAUR-like auxin-responsive pro...		Lus10012185 [exp]	22.0	0.9887
AT1G10740			alpha/beta-Hydrolases superfam...		Lus10030585 [exp]	23.1	0.9554
AT5G54740		SESA5	seed storage albumin 5 (.1)		Lus10023513 [exp]	28.6	0.9837
AT4G34760			SAUR-like auxin-responsive pro...		Lus10028466 [exp]	28.7	0.9877
AT5G07010		ATST2A	ARABIDOPSIS THALIANA SULFOTRAN...		Lus10008673 [exp]	29.2	0.9597

Compare expression of checked genes

Lus10022258 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.