Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022267 pacid=23139393 polypeptide=Lus10022267 locus=Lus10022267.g ID=Lus10022267.BGIv1.0 annot-version=v1.0 ATGAAGGAGCCGTCGAATGTAGAGGGCGAATCTCACCAAAACCCTGCCGATAAAGAAGATATAACCGGCTCAGACGACGACAGAGTTCGTAGTCACCGCC GCACTGGAAGGAAGGGCAAGAAACCATGGGAGGATACCGAAAACATGCAACAACGGAAACAAGCTGTCGGCAGACCAACAAAACCCTCATCTGCATCTCA AGAAGCTGGAGAATCATCAATGGGAAGTCACAAAACCAACATGAAGCAGCCGAATAAGCATGTAAAAAGGAGTTAA
AA sequence Show only first row Show all	>Lus10022267 pacid=23139393 polypeptide=Lus10022267 locus=Lus10022267.g ID=Lus10022267.BGIv1.0 annot-version=v1.0 MKEPSNVEGESHQNPADKEDITGSDDDRVRSHRRTGRKGKKPWEDTENMQQRKQAVGRPTKPSSASQEAGESSMGSHKTNMKQPNKHVKRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022267 [exp]	0	1
AT3G09290	C2H2ZnF	TAC1	telomerase activator1 (.1)		Lus10021213 [exp]	5.0	0.8393
AT3G02100			UDP-Glycosyltransferase superf...		Lus10003456 [exp]	9.2	0.8276
AT4G29340		PRF4	profilin 4 (.1)		Lus10012935 [exp]	10.6	0.8276
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10039454 [exp]	11.0	0.8320
AT2G31180	MYB	ATMYB14, Myb14a...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10022021 [exp]	11.8	0.8276
AT4G30030			Eukaryotic aspartyl protease f...		Lus10031450 [exp]	13.2	0.8260
AT2G04810			Protein of unknown function (D...		Lus10020538 [exp]	15.0	0.8231
AT4G16270			Peroxidase superfamily protein...		Lus10017069 [exp]	15.0	0.8249
AT1G14290		SBH2	sphingoid base hydroxylase 2 (...		Lus10006058 [exp]	15.6	0.6891
AT4G27290			S-locus lectin protein kinase ...		Lus10034815 [exp]	16.9	0.8200

Compare expression of checked genes

Lus10022267 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.