Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40500 133 / 1e-41 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002519 [exp] 172 / 4e-57 AT5G40500 155 / 4e-50 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G344700 [exp] 149 / 6e-48 AT5G40500 140 / 1e-44 unknown protein Potri.017G071300 [exp] 147 / 3e-47 AT5G40500 139 / 6e-44 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022273 pacid=23139511 polypeptide=Lus10022273 locus=Lus10022273.g ID=Lus10022273.BGIv1.0 annot-version=v1.0 ATGGCGATGGCGTCTTGGAGCTATTCCAGTGCCTATAAGAAGGCTCCCTCTCTTCGAATTTTGTGCAGAAAGAAAGAAAGAGATCATCATATTCTTCCTT ACAAAGTCATCGAGATCACTCCGCCTCCTAAGAACCTCGGCATCCGTTGCCTTCCTCCCAACTTGCAATGTGGGGAGAGCGTGACAATCGAAGGCCAAGC GTATACAGTGTCAGCGGTAACTCATCGATACCAGCTCCGGAAGGGAAAATATGAACCGAGTGAGAAGAGGCTTGATGTTCTGTCCACGGGGAGATACATG TTGAACTTATATTTAGAGAACTTGCTAGAACAATCCTGA
AA sequence Show only first row Show all	>Lus10022273 pacid=23139511 polypeptide=Lus10022273 locus=Lus10022273.g ID=Lus10022273.BGIv1.0 annot-version=v1.0 MAMASWSYSSAYKKAPSLRILCRKKERDHHILPYKVIEITPPPKNLGIRCLPPNLQCGESVTIEGQAYTVSAVTHRYQLRKGKYEPSEKRLDVLSTGRYM LNLYLENLLEQS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G40500			unknown protein		Lus10022273 [exp]	0	1
AT3G61880		CYP78A9	cytochrome p450 78a9 (.1.2)		Lus10017334 [exp]	9.2	0.7985
AT1G65295			unknown protein		Lus10020197 [exp]	9.6	0.8124
AT2G06520		PSBX	photosystem II subunit X (.1)		Lus10026458 [exp]	11.0	0.8598
AT1G65295			unknown protein		Lus10026997 [exp]	11.8	0.8029
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10016499 [exp]	15.5	0.8205
AT4G13540			unknown protein		Lus10004393 [exp]	16.2	0.8065
AT5G13720			Uncharacterised protein family...		Lus10016380 [exp]	16.8	0.8514
AT3G15810			Protein of unknown function (D...		Lus10016666 [exp]	18.5	0.8312
AT5G66090			unknown protein		Lus10041868 [exp]	18.8	0.7962
AT5G67390			unknown protein		Lus10019291 [exp]	21.0	0.8114

Compare expression of checked genes

Lus10022273 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.