Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G11530 59 / 1e-11 CRK34 cysteine-rich RLK (RECEPTOR-like protein kinase) 34 (.1) AT4G23150 59 / 1e-11 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1) AT4G23130 57 / 5e-11 RLK6, CRK5 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2) AT4G04500 57 / 1e-10 CRK37 cysteine-rich RLK (RECEPTOR-like protein kinase) 37 (.1) AT4G23260 56 / 2e-10 CRK18 cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.2) AT4G23250 56 / 2e-10 RKC1, CRK17, DUF26-21, EMB1290 RECEPTOR-LIKE KINASE THALIANACOL-0GENOMICLIBRARY\(CLONTECH\).THEPOSITIVEPHAGECLONES C-X8-C-X2-C CLASS 1, EMBRYO DEFECTIVE 1290, CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 17, kinases;protein kinases (.1) AT4G23280 56 / 3e-10 CRK20 cysteine-rich RLK (RECEPTOR-like protein kinase) 20 (.1) AT4G05200 55 / 3e-10 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) AT4G23140 55 / 4e-10 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT4G23180 55 / 4e-10 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003660 [exp] 88 / 2e-22 AT4G05200 117 / 3e-29 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10018382 [exp] 62 / 1e-12 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Lus10007632 [exp] 62 / 1e-12 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10007633 [exp] 61 / 4e-12 AT4G05200 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10018381 [exp] 59 / 1e-11 AT4G23180 283 / 3e-91 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10018379 [exp] 57 / 1e-10 AT4G23180 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10038552 [exp] 57 / 1e-10 AT4G27290 879 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10026629 [exp] 56 / 3e-10 AT4G23180 540 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10007635 [exp] 54 / 1e-09 AT4G21410 385 / 6e-122 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G028800 [exp] 58 / 3e-11 AT4G21410 573 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.011G029000 [exp] 58 / 3e-11 AT4G21410 537 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.004G026350 [exp] 58 / 3e-11 AT4G21410 610 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.011G030000 [exp] 58 / 4e-11 AT4G21410 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.011G029700 [exp] 58 / 4e-11 AT4G21410 578 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.001G411700 [exp] 53 / 2e-09 AT4G27290 800 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G024800 [exp] 52 / 4e-09 AT4G23180 663 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G028466 [exp] 52 / 5e-09 AT1G11340 884 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028600 [exp] 52 / 5e-09 AT1G11340 875 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G024500 [exp] 52 / 6e-09 AT4G23180 675 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022285 pacid=23139366 polypeptide=Lus10022285 locus=Lus10022285.g ID=Lus10022285.BGIv1.0 annot-version=v1.0 ATGAACCCCAAGATTGCAGATTTTGGGATGGCTAGACTGTTTGATATTGATGAAACACAAGGCAATACCAAGAGAATTGTCGGAACCATTGACTCGCTGA GTCTGCAGCTGCCTTCGAGGTCGGGGTTTTTCATGCACACCGACACCGATGGTGATCAACTCAACAACAATGGAGGCTCGTGGAGTTTCAGCAGCGCTTT AAGGAAGGCTGTTAGTTCTTCTCCTTCTACACAAGTGCTCTCTCTATCTCAAAATGATGTCTCTGTAACTGAACTTTATCCTCGCTAA
AA sequence Show only first row Show all	>Lus10022285 pacid=23139366 polypeptide=Lus10022285 locus=Lus10022285.g ID=Lus10022285.BGIv1.0 annot-version=v1.0 MNPKIADFGMARLFDIDETQGNTKRIVGTIDSLSLQLPSRSGFFMHTDTDGDQLNNNGGSWSFSSALRKAVSSSPSTQVLSLSQNDVSVTELYPR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G11530		CRK34	cysteine-rich RLK (RECEPTOR-li...		Lus10022285 [exp]	0	1
AT3G53180		NodGS	nodulin/glutamine synthase-lik...		Lus10023904 [exp]	1.0	1.0000
					Lus10000380 [exp]	2.0	1.0000
					Lus10010383 [exp]	2.4	1.0000
AT2G39080		EMB2799	EMBRYO DEFECTIVE 2799, NAD(P)-...		Lus10037911 [exp]	2.8	0.9994
AT2G24280			alpha/beta-Hydrolases superfam...		Lus10024449 [exp]	3.5	0.9856
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10015092 [exp]	3.7	0.9820
					Lus10009632 [exp]	3.9	0.9972
AT5G18190			Protein kinase family protein ...		Lus10043244 [exp]	4.5	0.9482
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039501 [exp]	4.9	0.9672
AT3G03380		DEG7, DEGP7	degradation of periplasmic pro...		Lus10017636 [exp]	5.3	0.8971

Compare expression of checked genes

Lus10022285 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.