Lus10022295 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14410 59 / 8e-12 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003654 147 / 1e-43 AT3G01650 376 / 2e-127 RING domain ligase1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G342100 74 / 1e-17 AT5G14410 67 / 4e-15 unknown protein
PFAM info
Representative CDS sequence
>Lus10022295 pacid=23139390 polypeptide=Lus10022295 locus=Lus10022295.g ID=Lus10022295.BGIv1.0 annot-version=v1.0
ATGGAGTTGCTGATGCCCAGGAGGATGCTGTCCAATTACCAAAAGCTTCACAAAGATGACGAGGAGGAGGAAGATGGAGGAGGAGGAGGAGGAGTTGGTA
GCAGGAGTATCAACTGGTTCAAGTTCAGAAGGTTTCAGTGGAGGAGGAGATCAAGGAGAAGAAGAAGACCATCTTCATCATCTTCCTTCATTAGGCTTAA
AGTTTCGAGCCTTGTGAAGAGGAGGAAAGATGTGATGAAGATGTTTAGAGTTTCGATCAGGAAAGTGTTGAAGAGATTGAAGGATGGTCAAGATCACTTT
GGCGATCTTTTTGCTGGGAACTATCTCTTCTTGCAAATCAATCCTACTTCCTTCAAGTCATTGCAGAAATCTTACACTGTCCCTCGGCCTCCTCCTGCTT
TCTTAACTTGA
AA sequence
>Lus10022295 pacid=23139390 polypeptide=Lus10022295 locus=Lus10022295.g ID=Lus10022295.BGIv1.0 annot-version=v1.0
MELLMPRRMLSNYQKLHKDDEEEEDGGGGGGVGSRSINWFKFRRFQWRRRSRRRRRPSSSSSFIRLKVSSLVKRRKDVMKMFRVSIRKVLKRLKDGQDHF
GDLFAGNYLFLQINPTSFKSLQKSYTVPRPPPAFLT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14410 unknown protein Lus10022295 0 1
AT5G42750 BKI1 BRI1 kinase inhibitor 1 (.1) Lus10021736 6.2 0.8666
AT5G38220 alpha/beta-Hydrolases superfam... Lus10017617 12.0 0.7307
Lus10008379 13.7 0.8236
AT5G46530 AWPM-19-like family protein (.... Lus10015255 14.8 0.8175
AT3G25820 ATTPS-CIN "terpene synthase-like sequenc... Lus10006356 16.1 0.8046
AT1G61600 Protein of unknown function (D... Lus10031916 16.1 0.8270
AT4G36250 ALDH3F1 aldehyde dehydrogenase 3F1 (.1... Lus10028357 20.1 0.8051
AT2G14110 Haloacid dehalogenase-like hyd... Lus10007071 27.1 0.7649
AT4G16400 unknown protein Lus10039068 31.0 0.8164
AT1G68330 unknown protein Lus10041430 34.3 0.7014

Lus10022295 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.