Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53540 42 / 3e-06 HSP20-like chaperones superfamily protein (.1) AT5G59720 41 / 7e-06 HSP18.2 HSP18.1CI heat shock protein 18.2 (.1) AT3G46230 41 / 8e-06 ATHSP17.4 ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.4, heat shock protein 17.4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040830 [exp] 42 / 3e-06 AT1G53540 236 / 6e-81 HSP20-like chaperones superfamily protein (.1) Lus10009085 [exp] 42 / 3e-06 AT1G53540 232 / 2e-79 HSP20-like chaperones superfamily protein (.1) Lus10040723 [exp] 40 / 2e-05 AT2G29500 219 / 3e-74 HSP20-like chaperones superfamily protein (.1) Lus10016458 [exp] 40 / 2e-05 AT2G29500 214 / 3e-72 HSP20-like chaperones superfamily protein (.1) Lus10040722 [exp] 40 / 2e-05 AT1G07400 214 / 2e-72 HSP20-like chaperones superfamily protein (.1) Lus10016456 [exp] 40 / 2e-05 AT1G07400 213 / 8e-72 HSP20-like chaperones superfamily protein (.1) Lus10016457 [exp] 40 / 3e-05 AT1G07400 216 / 4e-73 HSP20-like chaperones superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G339150 [exp] 47 / 5e-08 AT1G53540 105 / 9e-30 HSP20-like chaperones superfamily protein (.1) Potri.006G093500 [exp] 45 / 2e-07 AT5G59720 150 / 3e-47 heat shock protein 18.2 (.1) Potri.008G062350 [exp] 45 / 3e-07 AT5G59720 196 / 3e-65 heat shock protein 18.2 (.1) Potri.010G195700 [exp] 45 / 3e-07 AT5G59720 190 / 1e-62 heat shock protein 18.2 (.1) Potri.001G238700 [exp] 44 / 6e-07 AT1G53540 195 / 8e-65 HSP20-like chaperones superfamily protein (.1) Potri.008G062300 [exp] 44 / 6e-07 AT5G59720 198 / 9e-66 heat shock protein 18.2 (.1) Potri.001G254700 [exp] 42 / 2e-06 AT2G29500 167 / 3e-54 HSP20-like chaperones superfamily protein (.1) Potri.009G049800 [exp] 42 / 3e-06 AT2G29500 152 / 4e-48 HSP20-like chaperones superfamily protein (.1) Potri.004G187202 [exp] 42 / 6e-06 AT2G29500 209 / 1e-70 HSP20-like chaperones superfamily protein (.1) Potri.019G081200 [exp] 41 / 8e-06 AT2G29500 186 / 3e-61 HSP20-like chaperones superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022314 pacid=23139477 polypeptide=Lus10022314 locus=Lus10022314.g ID=Lus10022314.BGIv1.0 annot-version=v1.0 ATGGCATACATAGCAGATCGAGATGGCCTATCAGACGGCGGAAGAGTGCTCCAGATCAGTGGAGAAAGGCCACCGCCTGATGATGATCATGATGATAATG ATGGCGACGGAGGTGGTGGCAGGAGGAACAAGTGGCATAGGGTTGAACGTTGCAGGGGGAAGTTCCTCCGTAGATTCCAGCTGCGGAGAATGCCATGGCG GGTGATCAGGTGA
AA sequence Show only first row Show all	>Lus10022314 pacid=23139477 polypeptide=Lus10022314 locus=Lus10022314.g ID=Lus10022314.BGIv1.0 annot-version=v1.0 MAYIADRDGLSDGGRVLQISGERPPPDDDHDDNDGDGGGGRRNKWHRVERCRGKFLRRFQLRRMPWRVIR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59720		HSP18.2 HSP18.1...	heat shock protein 18.2 (.1)		Lus10022314 [exp]	0	1
AT3G50310		MKKK20, MAPKKK2...	MAPKK kinase 20, mitogen-activ...		Lus10029047 [exp]	3.2	0.7035
AT1G17930			Aminotransferase-like, plant m...		Lus10004830 [exp]	5.2	0.7052
AT2G40780			Nucleic acid-binding, OB-fold-...		Lus10030510 [exp]	10.8	0.6656
AT5G39200			unknown protein		Lus10030710 [exp]	12.5	0.6656
AT4G17920			RING/U-box superfamily protein...		Lus10030972 [exp]	14.0	0.6656
AT2G42850		CYP718	"cytochrome P450, family 718",...		Lus10031391 [exp]	15.3	0.6656
					Lus10002099 [exp]	16.5	0.6656
					Lus10011594 [exp]	17.7	0.6656
AT1G17930			Aminotransferase-like, plant m...		Lus10005495 [exp]	18.7	0.6656
					Lus10025316 [exp]	19.7	0.6656

Compare expression of checked genes

Lus10022314 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.