Lus10022315 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14360 148 / 2e-45 Ubiquitin-like superfamily protein (.1)
AT5G40630 139 / 5e-42 Ubiquitin-like superfamily protein (.1)
AT5G62100 79 / 4e-18 ATBAG2 BCL-2-associated athanogene 2 (.1.2.3)
AT5G07220 78 / 4e-17 ATBAG3 BCL-2-associated athanogene 3 (.1)
AT5G52060 73 / 2e-15 ATBAG1 BCL-2-associated athanogene 1 (.1)
AT3G51780 72 / 3e-15 ATBAG4 BCL-2-associated athanogene 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014884 282 / 6e-98 AT5G14360 158 / 2e-49 Ubiquitin-like superfamily protein (.1)
Lus10032107 145 / 7e-44 AT5G40630 136 / 4e-41 Ubiquitin-like superfamily protein (.1)
Lus10005051 93 / 3e-22 AT3G51780 221 / 1e-69 BCL-2-associated athanogene 4 (.1)
Lus10027822 91 / 8e-22 AT3G51780 221 / 4e-71 BCL-2-associated athanogene 4 (.1)
Lus10027420 90 / 2e-21 AT5G52060 349 / 6e-120 BCL-2-associated athanogene 1 (.1)
Lus10023279 88 / 3e-21 AT5G07220 196 / 4e-62 BCL-2-associated athanogene 3 (.1)
Lus10038882 82 / 1e-18 AT5G52060 327 / 1e-111 BCL-2-associated athanogene 1 (.1)
Lus10015004 82 / 1e-18 AT5G52060 333 / 4e-114 BCL-2-associated athanogene 1 (.1)
Lus10029598 67 / 3e-13 AT5G52060 195 / 8e-61 BCL-2-associated athanogene 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G339100 164 / 1e-51 AT5G14360 166 / 6e-53 Ubiquitin-like superfamily protein (.1)
Potri.009G074300 108 / 5e-29 AT3G51780 196 / 4e-62 BCL-2-associated athanogene 4 (.1)
Potri.001G279500 103 / 3e-27 AT3G51780 210 / 2e-67 BCL-2-associated athanogene 4 (.1)
Potri.015G135500 87 / 3e-20 AT5G52060 303 / 2e-101 BCL-2-associated athanogene 1 (.1)
Potri.012G133400 83 / 1e-18 AT5G52060 305 / 2e-102 BCL-2-associated athanogene 1 (.1)
Potri.003G121500 82 / 1e-18 AT5G52060 243 / 1e-78 BCL-2-associated athanogene 1 (.1)
Potri.001G358200 76 / 9e-17 AT5G07220 207 / 9e-66 BCL-2-associated athanogene 3 (.1)
Potri.001G110300 77 / 1e-16 AT5G52060 239 / 2e-76 BCL-2-associated athanogene 1 (.1)
Potri.016G121200 63 / 7e-12 AT3G51780 218 / 1e-70 BCL-2-associated athanogene 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
Representative CDS sequence
>Lus10022315 pacid=23139420 polypeptide=Lus10022315 locus=Lus10022315.g ID=Lus10022315.BGIv1.0 annot-version=v1.0
ATGATGTTGAAGTTGAAGTACAAGAAACTGTGCAGAGGGATCAGCTCCAAGCTAATTGGTGGAAGCAAGAAGACTAGTACTGATCATCAAAAAGGGTCAC
CAAGATCATCATTATCACCATCATCTTCTTCCTTGTCATCATCATTTTCCTCTTCATCATCCAATAATGGTGACATAAAATGGGAGGTTAGGCCAGGTGG
GATGCTGGTCCAGAAAAGGCAACAAAATGGTGATACCACCACCACCAGCACCACCAGTACTGAAGAGTTGCTCACACTCAGGGTTTCAACTGTTTCCCAA
TTGCATCATATCTCCATTGAAGCCACTTCCACCTTTGGGGAACTGAAGATGATGTTGGCATTGGTGACAAACTTGGAGCCAAAGGAGCAAAGGGTATTGT
TCAAAGGGAAAGAAAGGGAAGACAGTGAGTATCTACACATGGTTGGGGTTAGAGACAAAGACAAAGTGTTGCTTTTGGAAGATCCAGCAATCAAGGATAA
GAAGCTCAGACTGCAACAGGCACGCATGATCTCCTCTGTTCATCATCTCCACCACCAACATCCACTTGCTAATTATTGCAGCATTACATGTATAGCGTGT
AATTAG
AA sequence
>Lus10022315 pacid=23139420 polypeptide=Lus10022315 locus=Lus10022315.g ID=Lus10022315.BGIv1.0 annot-version=v1.0
MMLKLKYKKLCRGISSKLIGGSKKTSTDHQKGSPRSSLSPSSSSLSSSFSSSSSNNGDIKWEVRPGGMLVQKRQQNGDTTTTSTTSTEELLTLRVSTVSQ
LHHISIEATSTFGELKMMLALVTNLEPKEQRVLFKGKEREDSEYLHMVGVRDKDKVLLLEDPAIKDKKLRLQQARMISSVHHLHHQHPLANYCSITCIAC
N

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14360 Ubiquitin-like superfamily pro... Lus10022315 0 1
AT1G63220 Calcium-dependent lipid-bindin... Lus10029565 2.0 0.8282
AT3G59920 ATGDI2 RAB GDP dissociation inhibitor... Lus10027094 2.8 0.8329
AT5G27930 Protein phosphatase 2C family ... Lus10015206 2.8 0.8103
AT1G04690 KV-BETA1, KAB1 potassium channel beta subunit... Lus10011751 6.0 0.8022
AT5G25450 Cytochrome bd ubiquinol oxidas... Lus10008081 7.1 0.8160
AT1G63220 Calcium-dependent lipid-bindin... Lus10002235 7.4 0.8060
AT3G10330 Cyclin-like family protein (.1... Lus10031055 8.0 0.7805
AT3G59920 ATGDI2 RAB GDP dissociation inhibitor... Lus10008341 9.4 0.7955
AT1G04690 KV-BETA1, KAB1 potassium channel beta subunit... Lus10023674 11.2 0.7963
AT1G11360 Adenine nucleotide alpha hydro... Lus10018515 12.0 0.7932

Lus10022315 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.