Lus10022323 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G27340 179 / 7e-59 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014875 221 / 3e-75 AT3G27340 154 / 1e-48 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G336600 213 / 2e-72 AT3G27340 207 / 4e-70 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06155 GBBH-like_N Gamma-butyrobetaine hydroxylase-like, N-terminal
Representative CDS sequence
>Lus10022323 pacid=23139411 polypeptide=Lus10022323 locus=Lus10022323.g ID=Lus10022323.BGIv1.0 annot-version=v1.0
ATGCTGGGAGTACAAAGAGCTACCATGAGGGCAATCCAAACAAGCGTTGCCGGTCCGCGGCTCACTAAATTCACTCTTCGAGCGCCCAAACGAGTAGAAG
TGGAATATGGGAATGGTGACAAGTTTAGCCTGTCAGCCGAATTTTTAAGAATCCACAGCCCTGCCGTTGATGGGAAAGTTAGGTCAATTGGTGGTGAAAA
GGTGATATCAGGGCGTCGTCATGTAGGAATAATTTCTGCAGAACCTGTAGGAAACTATGGGGTAAGGATAGTGTTTGATGATCTGCATAAAACTGGGATC
TTTACCTGGGACTATTTCTTTCATCTGGGAATCAACAAATTCTCCTTGAGCAGAGACTATATCAGGACATTGAAGAGGCATGGACTTAGCCGCGATCCAG
CAAGGAGACGTTCACCTTCCTGA
AA sequence
>Lus10022323 pacid=23139411 polypeptide=Lus10022323 locus=Lus10022323.g ID=Lus10022323.BGIv1.0 annot-version=v1.0
MLGVQRATMRAIQTSVAGPRLTKFTLRAPKRVEVEYGNGDKFSLSAEFLRIHSPAVDGKVRSIGGEKVISGRRHVGIISAEPVGNYGVRIVFDDLHKTGI
FTWDYFFHLGINKFSLSRDYIRTLKRHGLSRDPARRRSPS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G27340 unknown protein Lus10022323 0 1
AT3G14460 LRR and NB-ARC domains-contain... Lus10039548 7.4 0.8780
AT3G51390 DHHC-type zinc finger family p... Lus10041837 8.7 0.8915
AT2G30270 Protein of unknown function (D... Lus10042235 11.4 0.8847
AT4G10170 SNARE-like superfamily protein... Lus10002944 11.4 0.8923
AT1G59600 ZCW7 ZCW7 (.1) Lus10018676 12.5 0.8855
AT1G62680 Pentatricopeptide repeat (PPR)... Lus10024962 12.8 0.8553
AT1G05410 Protein of unknown function (D... Lus10041201 13.2 0.8924
AT3G58670 Protein of unknown function (D... Lus10033603 16.1 0.8548
AT1G09220 Pentatricopeptide repeat (PPR)... Lus10011341 20.1 0.8785
AT3G50520 Phosphoglycerate mutase family... Lus10014360 23.7 0.8556

Lus10022323 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.