Plant FIBer expression Database

Lus10022331 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G01740 119 / 7e-36 Mitochondrial ribosomal protein L37 (.1)
AT5G14290 105 / 3e-30 Mitochondrial ribosomal protein L37 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041583
[exp]
191 / 7e-64 AT5G14290 147 / 1e-46 Mitochondrial ribosomal protein L37 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G335600
[exp]
133 / 4e-41 AT3G01740 140 / 3e-44 Mitochondrial ribosomal protein L37 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08561 Ribosomal_L37 Mitochondrial ribosomal protein L37
Representative CDS sequence
>Lus10022331 pacid=23139499 polypeptide=Lus10022331 locus=Lus10022331.g ID=Lus10022331.BGIv1.0 annot-version=v1.0
ATGGCAATGAATCATGTAAGGTCGTTGAGAGATTTCGTCCTTTGTAAAGAAGTAGTTGGAGTGCGAACTTTTGCAGCCGGTGCTAAAGCGAAGAAGGGTT
CTAAGGGTGGGGCGGCTGCAGATGCCCCAAAAGTTTCAAGTCTTAGTAAAGAAGTGAAGTCTTCTACATGTGTTGGTGCCAATATTCTGAAGGATGGCAC
TGACCCAAAAGTCTTGGCGGATTCTGATTACCCTGAATGGCTGTGGCATCTTCTTGATAAACGTCCAGCATTGAGTGAACTCAGGAGGAAGGACAAACAT
TCACTATTGTATGAAGATCTGAAACGCTATTTCAAGCTAGACAGACGGGCAGGCATTAAAGAAAACAACTCTACTAAGGCCAAGAATTGA
AA sequence
>Lus10022331 pacid=23139499 polypeptide=Lus10022331 locus=Lus10022331.g ID=Lus10022331.BGIv1.0 annot-version=v1.0
MAMNHVRSLRDFVLCKEVVGVRTFAAGAKAKKGSKGGAAADAPKVSSLSKEVKSSTCVGANILKDGTDPKVLADSDYPEWLWHLLDKRPALSELRRKDKH
SLLYEDLKRYFKLDRRAGIKENNSTKAKN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14290 Mitochondrial ribosomal protei... Lus10022331
[exp]
0 1
AT5G58030 Transport protein particle (TR... Lus10003350
[exp]
10.1 0.8199
AT1G77750 Ribosomal protein S13/S18 fami... Lus10035785
[exp]
13.4 0.8137
AT3G05760 C2H2ZnF C2H2 and C2HC zinc fingers sup... Lus10010928
[exp]
18.1 0.8133
AT5G14250 CSN3, FUS11, CO... FUSCA 11, COP9 SIGNALOSOME SUB... Lus10041586
[exp]
21.2 0.8176
AT1G01210 DNA-directed RNA polymerase, s... Lus10005984
[exp]
36.1 0.7967
AT2G23940 Protein of unknown function (D... Lus10041903
[exp]
46.1 0.7859
AT4G38520 Protein phosphatase 2C family ... Lus10024008
[exp]
47.1 0.7264
AT4G01710 ARPC5, CRK CROOKED, ARP2/3 complex 16 kDa... Lus10028192
[exp]
50.3 0.7896
AT1G61780 postsynaptic protein-related (... Lus10007644
[exp]
56.2 0.7883
AT5G55940 EMB2731 embryo defective 2731, Unchara... Lus10032594
[exp]
56.3 0.7230

Lus10022331 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.