Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38695 47 / 3e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G190101 [exp] 44 / 6e-06 AT2G38695 213 / 4e-70 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022334 pacid=23139479 polypeptide=Lus10022334 locus=Lus10022334.g ID=Lus10022334.BGIv1.0 annot-version=v1.0 ATGAGCTCGAAAGTTGCCAAGCTAGGGTTAGCAGCTGTACTGGCTTACGGTTTGTTTGACGGAGTGACGTATACGTCTTTCTTTGTGCTTGCTTTCCTTG GGTACGAGAAGAGCACCGGGAAGAACCCTGCCGCCAATCTACAGGCTCTCCTCGGGATAGTGATATTGATGTGGACGGGGAACAACGTAACGAGGCCGTT TAGGGTGGCTGGAGCAGCAGCGTTGGCACCATTGATTGACAGAGGATTGAAGAGGATACAGAGCTACTTCAACTTCCCCAGACTTGTCCATGCTTTTGCT CTCGTGGTCTCCATTGTCGCCGTCACCTGTGGAACAATCGTCGGGTTGCTTATACTTTCCAGATGGGGGAAATGA
AA sequence Show only first row Show all	>Lus10022334 pacid=23139479 polypeptide=Lus10022334 locus=Lus10022334.g ID=Lus10022334.BGIv1.0 annot-version=v1.0 MSSKVAKLGLAAVLAYGLFDGVTYTSFFVLAFLGYEKSTGKNPAANLQALLGIVILMWTGNNVTRPFRVAGAAALAPLIDRGLKRIQSYFNFPRLVHAFA LVVSIVAVTCGTIVGLLILSRWGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38695			unknown protein		Lus10022334 [exp]	0	1
AT3G29280			unknown protein		Lus10018197 [exp]	3.7	0.7697
AT3G11210			SGNH hydrolase-type esterase s...		Lus10004815 [exp]	4.0	0.7933
AT1G52870			Peroxisomal membrane 22 kDa (M...		Lus10032655 [exp]	11.5	0.7362
AT2G42940	AT-hook		Predicted AT-hook DNA-binding ...		Lus10031458 [exp]	19.1	0.7513
AT1G53710			Calcineurin-like metallo-phosp...		Lus10042936 [exp]	27.7	0.7395
AT4G32920			glycine-rich protein (.1.2.3)		Lus10000229 [exp]	48.0	0.6988
AT4G21192			Cytochrome c oxidase biogenesi...		Lus10019246 [exp]	50.0	0.7372
AT5G47760		ATPK5, ATPGLP2	2-phosphoglycolate phosphatase...		Lus10038760 [exp]	59.7	0.6803
AT4G31130			Protein of unknown function (D...		Lus10030037 [exp]	67.5	0.7177
AT1G62350			Pentatricopeptide repeat (PPR)...		Lus10036049 [exp]	68.1	0.6600

Compare expression of checked genes

Lus10022334 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.