Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20510 93 / 2e-23 OPCL1 OPC-8:0 CoA ligase1 (.1.2) AT5G63380 90 / 4e-22 AMP-dependent synthetase and ligase family protein (.1) AT1G20500 82 / 1e-19 AMP-dependent synthetase and ligase family protein (.1) AT5G38120 81 / 6e-19 4CL8 AMP-dependent synthetase and ligase family protein (.1) AT4G19010 80 / 8e-19 AMP-dependent synthetase and ligase family protein (.1) AT1G20480 80 / 1e-18 AMP-dependent synthetase and ligase family protein (.1) AT4G05160 79 / 2e-18 AMP-dependent synthetase and ligase family protein (.1) AT1G65060 73 / 4e-16 4CL3 4-coumarate:CoA ligase 3 (.1.2) AT3G21240 67 / 4e-14 AT4CL2, 4CL2 4-coumarate:CoA ligase 2 (.1) AT1G51680 65 / 1e-13 AT4CL1, 4CL.1, 4CL1 ARABIDOPSIS THALIANA 4-COUMARATE:COA LIGASE 1, 4-coumarate:CoA ligase 1 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041584 [exp] 145 / 9e-46 AT5G63380 180 / 2e-54 AMP-dependent synthetase and ligase family protein (.1) Lus10002791 [exp] 95 / 6e-24 AT5G63380 688 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Lus10016630 [exp] 86 / 9e-21 AT4G19010 532 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Lus10026544 [exp] 82 / 2e-19 AT4G05160 642 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Lus10013831 [exp] 81 / 7e-19 AT4G05160 654 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Lus10015999 [exp] 81 / 7e-19 AT1G20510 692 / 0.0 OPC-8:0 CoA ligase1 (.1.2) Lus10012280 [exp] 81 / 8e-19 AT1G20510 825 / 0.0 OPC-8:0 CoA ligase1 (.1.2) Lus10015998 [exp] 80 / 1e-18 AT1G20510 833 / 0.0 OPC-8:0 CoA ligase1 (.1.2) Lus10036994 [exp] 77 / 1e-17 AT5G63380 516 / 4e-179 AMP-dependent synthetase and ligase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G033600 [exp] 99 / 3e-25 AT5G63380 598 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.015G092300 [exp] 89 / 8e-22 AT5G63380 594 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.005G248500 [exp] 88 / 2e-21 AT1G20510 795 / 0.0 OPC-8:0 CoA ligase1 (.1.2) Potri.012G094800 [exp] 87 / 3e-21 AT5G63380 657 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.002G012800 [exp] 87 / 4e-21 AT1G20510 769 / 0.0 OPC-8:0 CoA ligase1 (.1.2) Potri.012G094900 [exp] 87 / 5e-21 AT5G63380 604 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.012G095000 [exp] 86 / 1e-20 AT5G63380 615 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.008G031500 [exp] 85 / 2e-20 AT1G20510 466 / 3e-159 OPC-8:0 CoA ligase1 (.1.2) Potri.010G230200 [exp] 84 / 3e-20 AT1G20510 478 / 7e-164 OPC-8:0 CoA ligase1 (.1.2) Potri.010G057000 [exp] 76 / 4e-17 AT5G63380 530 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022336 pacid=23139457 polypeptide=Lus10022336 locus=Lus10022336.g ID=Lus10022336.BGIv1.0 annot-version=v1.0 ATGGGGATCGGTTGGGAGGCTAAACGGGGATGTCGAAGCAAGAATTGTCGATACCGAAACCAAGAAAGCTCTGCCTCCTGGGAAGCAGGCAACGATTGTA GGTATCCGGATGAGGAGGCAGGGCAGGTGCCATTTGCATTTGTGGTGAGGGGTGCAGGGAGCAGCAGCCTTGATGCAGGAGCAGTAATAGAGTTTGTAGC AAAACAGGTTGCGCCTTACAAAAAGATAAGGCGGGTGGCGTTTGTGAGTTCAATACCTACAAGCCCTGCTGGTAAAATTCTGAGGAAGGACTTGAAGAAG ATGTTGCCATCAACTCCCAAGCCTAGATTGTAG
AA sequence Show only first row Show all	>Lus10022336 pacid=23139457 polypeptide=Lus10022336 locus=Lus10022336.g ID=Lus10022336.BGIv1.0 annot-version=v1.0 MGIGWEAKRGCRSKNCRYRNQESSASWEAGNDCRYPDEEAGQVPFAFVVRGAGSSSLDAGAVIEFVAKQVAPYKKIRRVAFVSSIPTSPAGKILRKDLKK MLPSTPKPRL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G20510		OPCL1	OPC-8:0 CoA ligase1 (.1.2)		Lus10022336 [exp]	0	1
AT1G04985			unknown protein		Lus10015157 [exp]	1.0	0.9107
AT3G58670			Protein of unknown function (D...		Lus10017645 [exp]	2.8	0.8703
AT1G64970		VTE4, TMT1, G-T...	VITAMIN E DEFICIENT 4, gamma-t...		Lus10009537 [exp]	4.9	0.8591
AT2G13620		ATCHX15	CATION/H+ EXCHANGER 15, cation...		Lus10015268 [exp]	6.9	0.8651
AT5G28540		BIP1	heat shock protein 70 (Hsp 70)...		Lus10023016 [exp]	7.3	0.8645
AT3G11750		FOLB1	Dihydroneopterin aldolase (.1)		Lus10013600 [exp]	10.4	0.8571
AT5G19740			Peptidase M28 family protein (...		Lus10011133 [exp]	13.5	0.8284
					Lus10043270 [exp]	13.6	0.8610
AT5G42000			ORMDL family protein (.1.2)		Lus10033219 [exp]	15.8	0.8693
					Lus10003603 [exp]	17.1	0.8879

Compare expression of checked genes

Lus10022336 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.