Lus10022342 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G01820 234 / 4e-77 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT2G37250 155 / 7e-46 ADK, ATPADK1 adenosine kinase (.1)
AT2G39270 140 / 9e-40 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT4G25280 69 / 1e-13 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G50370 67 / 6e-13 Adenylate kinase family protein (.1)
AT3G60180 65 / 2e-12 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT5G63400 65 / 2e-12 ADK1 adenylate kinase 1 (.1.2)
AT5G26667 55 / 5e-09 PYR6 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
AT5G35170 57 / 6e-09 adenylate kinase family protein (.1.2)
AT3G60961 46 / 4e-06 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032057 317 / 3e-109 AT3G01820 244 / 5e-81 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10035224 312 / 2e-107 AT3G01820 242 / 3e-80 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10040358 158 / 9e-47 AT2G37250 405 / 1e-143 adenosine kinase (.1)
Lus10023476 158 / 1e-46 AT2G37250 407 / 2e-144 adenosine kinase (.1)
Lus10030296 157 / 2e-46 AT2G37250 395 / 1e-139 adenosine kinase (.1)
Lus10001984 155 / 1e-45 AT2G37250 391 / 4e-138 adenosine kinase (.1)
Lus10031714 67 / 3e-12 AT4G25270 672 / 0.0 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10031135 64 / 8e-12 AT4G25280 263 / 3e-89 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10036326 64 / 3e-11 AT5G35170 658 / 0.0 adenylate kinase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G333100 267 / 1e-89 AT3G01820 249 / 8e-83 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.015G093200 223 / 2e-72 AT3G01820 227 / 3e-74 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.010G215300 162 / 2e-48 AT2G37250 382 / 2e-134 adenosine kinase (.1)
Potri.008G046100 153 / 5e-45 AT2G37250 377 / 1e-132 adenosine kinase (.1)
Potri.012G095700 98 / 1e-25 AT3G01820 90 / 8e-23 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.012G095300 65 / 3e-12 AT5G63400 419 / 1e-150 adenylate kinase 1 (.1.2)
Potri.015G129000 62 / 3e-11 AT4G25280 301 / 6e-104 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.015G092800 59 / 3e-10 AT5G63400 425 / 6e-153 adenylate kinase 1 (.1.2)
Potri.018G113400 59 / 9e-10 AT5G35170 838 / 0.0 adenylate kinase family protein (.1.2)
Potri.002G134600 54 / 9e-09 AT5G26667 345 / 1e-122 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00406 ADK Adenylate kinase
Representative CDS sequence
>Lus10022342 pacid=23139434 polypeptide=Lus10022342 locus=Lus10022342.g ID=Lus10022342.BGIv1.0 annot-version=v1.0
ATGGCTGGTCTGAGTCGGGTGCGATTCGCTGCAGCCCCGTCGGCGCTCCGCCGCCTCGGATTGCTTGCCGGCCGCCGAGCTTACGGATCAGCGGCTGCAG
TTGAGTACAATTACTACGACGATGAAGATGAAGAGCGTTCCCATTACTCCGCACCGAGTGCTTCCCCTTCGCCAGGGAGCCTGGCGTCGGCGGCGGGGTT
GACGTCTGAGAGAGGAGTTCAGTGGGTGTTGATTGGAGATCCGGGAGTGAAGAAACACCGGTACGCAGAGAAACTCTCCAAAGTTCTACAAGTCCCTCAC
ATTTCCATGGGCACTCTCCTTCGGCAGGAGCTTAACCCTAGCTCTGCTCTTTACAAACAGATATTCAGTATAGTGAATGAAGGGAAGCTGGTACCCGAAG
AGGTCATATTTGGGCTGTTGACAAAGAGGCTTGAAGAGGGATACTCTAAAGGGGAAAGTGGCTTCATTTTGGACGGAATTCCCAGAACTAGATTGCAGGC
TGAGATTCTTGATGAAATTGCTGACATTGATTTGGTGGTGAACTTCAAATCTGCTGAACAAGGTCTGGTGAAAAGCAACTATGCCAGTGTAGGACATTCT
CCATCAGCTACTGGTTTGGGAAGATCCTATGAAGAGAAGTTCCGCGTATATGCAGAAGAGGGGAAGGCAGTGGAAAATTACTACAGGAAGCAGAGAAAGC
TTCTTGATTTTCAGGTGGCAGACGGACCAGGAGGAGATGCCTGGCAAGGCTTGTTGGCTGCTTTGCATCTCAAGAATGCAAGTGCACTGCTTTCTTCAAA
TGAAGTTGCTGCTTGA
AA sequence
>Lus10022342 pacid=23139434 polypeptide=Lus10022342 locus=Lus10022342.g ID=Lus10022342.BGIv1.0 annot-version=v1.0
MAGLSRVRFAAAPSALRRLGLLAGRRAYGSAAAVEYNYYDDEDEERSHYSAPSASPSPGSLASAAGLTSERGVQWVLIGDPGVKKHRYAEKLSKVLQVPH
ISMGTLLRQELNPSSALYKQIFSIVNEGKLVPEEVIFGLLTKRLEEGYSKGESGFILDGIPRTRLQAEILDEIADIDLVVNFKSAEQGLVKSNYASVGHS
PSATGLGRSYEEKFRVYAEEGKAVENYYRKQRKLLDFQVADGPGGDAWQGLLAALHLKNASALLSSNEVAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G01820 P-loop containing nucleoside t... Lus10022342 0 1
AT3G54920 PMR6 powdery mildew resistant 6, Pe... Lus10038679 1.7 0.7712
AT5G22740 ATCSLA2, ATCSLA... CELLULOSE SYNTHASE-LIKE A 2, A... Lus10009387 6.0 0.7520
AT3G54920 PMR6 powdery mildew resistant 6, Pe... Lus10037945 16.0 0.7472
AT3G18550 TCP AtBRC1, ATTCP18... BRANCHED 1, TCP family transcr... Lus10021713 44.4 0.6778
AT4G26430 CSN6B COP9 signalosome subunit 6B (.... Lus10025606 49.5 0.6852
AT5G22900 ATCHX3 cation/H+ exchanger 3, ARABIDO... Lus10041344 56.7 0.6610
AT1G24360 NAD(P)-binding Rossmann-fold s... Lus10015821 60.6 0.6822
AT4G33350 AtTic22-IV translocon at the inner envelo... Lus10009759 61.7 0.6682
AT3G62100 AUX_IAA IAA30 indole-3-acetic acid inducible... Lus10009967 81.8 0.6155
AT1G76890 Trihelix AT-GT2, GT2 Duplicated homeodomain-like su... Lus10042806 98.5 0.6636

Lus10022342 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.