Lus10022353 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02330 99 / 1e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G04780 97 / 4e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G09040 96 / 2e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G57430 92 / 2e-22 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G19720 91 / 7e-22 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT4G16470 90 / 1e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G50990 87 / 2e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G28660 86 / 2e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G28640 86 / 3e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G12770 86 / 6e-20 MEF22 mitochondrial editing factor 22 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022368 262 / 2e-82 AT2G13600 414 / 2e-129 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10008830 218 / 1e-70 AT4G02750 97 / 1e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000213 206 / 2e-63 AT2G13600 435 / 8e-144 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10007772 184 / 8e-57 AT4G37170 281 / 6e-87 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10010320 97 / 4e-24 AT2G34400 658 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10014212 91 / 6e-22 AT5G37570 561 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10030549 91 / 9e-22 AT4G02750 468 / 2e-154 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015256 89 / 3e-21 AT5G46460 840 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10027389 89 / 4e-21 AT5G66520 393 / 7e-131 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G018800 174 / 2e-51 AT2G13600 463 / 3e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G030200 99 / 1e-24 AT1G19720 985 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.001G014900 94 / 6e-23 AT5G59600 334 / 6e-108 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G136200 94 / 1e-22 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.012G108000 92 / 2e-22 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.010G020500 89 / 3e-21 AT2G36980 725 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G111300 89 / 4e-21 AT3G02330 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G075800 88 / 7e-21 AT3G57430 1189 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G059400 88 / 9e-21 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G072500 87 / 1e-20 AT3G21470 565 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10022353 pacid=23171683 polypeptide=Lus10022353 locus=Lus10022353.g ID=Lus10022353.BGIv1.0 annot-version=v1.0
ATGTGGAACTCCATGATTGTAGGATACGTAGATAACATTGGATGGCCATCGGAACAGATTGTACCGGATTCTTTTACGTTAGGAAGTGCCTTTAATGCTT
GTGCTAATATGGCTTCTTTGAGAAAGGGTAAGGAGATTCATTCTATTGCTATTTCCCGAGGGTTGCAATCTGATGCATTCGTAGGAGCAGTTCTTGTGGA
CATGTACTGTGCATGTCAGGATATAGTAGCTGCTCAGTTGGCTTTTGCTGAGGTTATTGATAACGATATCACCACCTGGAATGCTCTGATATTTGGATAC
GCTAGCTTACACGATACTGAAAAGGTTCAAGTTTTGCTTCAGCAAATGAGGGAAGATGGTCACGAACCGAATTCGTACACATGGAATGGTATTCTGAAAT
GTCATTTACAAGATGGCAAACTAGACTTAGCGGAGCAGTTATTATCTGAAATGCAATGA
AA sequence
>Lus10022353 pacid=23171683 polypeptide=Lus10022353 locus=Lus10022353.g ID=Lus10022353.BGIv1.0 annot-version=v1.0
MWNSMIVGYVDNIGWPSEQIVPDSFTLGSAFNACANMASLRKGKEIHSIAISRGLQSDAFVGAVLVDMYCACQDIVAAQLAFAEVIDNDITTWNALIFGY
ASLHDTEKVQVLLQQMREDGHEPNSYTWNGILKCHLQDGKLDLAEQLLSEMQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G02330 Pentatricopeptide repeat (PPR)... Lus10022353 0 1

Lus10022353 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.