Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40110 47 / 9e-08 Yippee family putative zinc-binding protein (.1.2) AT5G53940 43 / 5e-06 Yippee family putative zinc-binding protein (.1) AT3G11230 42 / 1e-05 Yippee family putative zinc-binding protein (.1.2) AT3G55890 41 / 2e-05 Yippee family putative zinc-binding protein (.1) AT3G08990 41 / 2e-05 Yippee family putative zinc-binding protein (.1.2) AT4G27745 37 / 0.0005 Yippee family putative zinc-binding protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008833 [exp] 137 / 1e-42 AT2G40110 54 / 8e-10 Yippee family putative zinc-binding protein (.1.2) Lus10022355 [exp] 119 / 7e-36 AT3G11230 62 / 4e-13 Yippee family putative zinc-binding protein (.1.2) Lus10023791 [exp] 95 / 3e-26 AT2G40110 62 / 2e-13 Yippee family putative zinc-binding protein (.1.2) Lus10004823 [exp] 58 / 5e-12 AT3G08990 69 / 4e-16 Yippee family putative zinc-binding protein (.1.2) Lus10022364 [exp] 50 / 1e-09 ND 34 / 0.001 Lus10040190 [exp] 52 / 2e-09 AT2G40110 228 / 1e-78 Yippee family putative zinc-binding protein (.1.2) Lus10028300 [exp] 51 / 4e-09 AT2G40110 228 / 8e-79 Yippee family putative zinc-binding protein (.1.2) Lus10008334 [exp] 47 / 3e-08 ND 35 / 3e-04 Lus10035531 [exp] 45 / 6e-07 AT3G08990 174 / 2e-57 Yippee family putative zinc-binding protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G190000 [exp] 49 / 2e-08 AT2G40110 224 / 6e-77 Yippee family putative zinc-binding protein (.1.2) Potri.008G067100 [exp] 48 / 8e-08 AT2G40110 232 / 1e-79 Yippee family putative zinc-binding protein (.1.2) Potri.016G115000 [exp] 43 / 5e-06 AT3G11230 154 / 2e-49 Yippee family putative zinc-binding protein (.1.2) Potri.012G019100 [exp] 40 / 5e-05 AT4G27745 202 / 2e-69 Yippee family putative zinc-binding protein (.1) Potri.011G115700 [exp] 40 / 5e-05 AT5G53940 187 / 1e-62 Yippee family putative zinc-binding protein (.1) Potri.015G009200 [exp] 39 / 9e-05 AT4G27745 201 / 1e-68 Yippee family putative zinc-binding protein (.1) Potri.001G085400 [exp] 39 / 0.0001 AT4G27745 197 / 3e-67 Yippee family putative zinc-binding protein (.1) Potri.003G145400 [exp] 39 / 0.0001 AT4G27745 179 / 3e-60 Yippee family putative zinc-binding protein (.1) Potri.012G019200 [exp] 37 / 0.0006 AT4G27740 131 / 4e-41 Yippee family putative zinc-binding protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0080 [flax] [poplar] Beta-tent PF03226 [flax] [poplar] Yippee-Mis18 Yippee zinc-binding/DNA-binding /Mis18, centromere assembly
Representative CDS sequence Show only first row Show all	>Lus10022354 pacid=23171777 polypeptide=Lus10022354 locus=Lus10022354.g ID=Lus10022354.BGIv1.0 annot-version=v1.0 ATGGCATCATCATCGAAGAAGGTATGCCCGTTCGACCATGTGGAAGGGAGAACCTACAACTGCAGAAACTGCCGTCTTTACATCGCCAGTGAAGATCAAA TATTCGTCAACCAGGCGTTCCAAGCCGCTAACAATGGACAGGCTGATCTCTTTGACAGAGTCAGCACTATGAATGTCGTATATGGAGATGCACGACAGGA AACTATAGAGGGAATTGAGTATGGTGGGAGAAACGCAGAATGTGCTGGCTGTCACTCAACCATTGGCTGGCAATATTTGTACGCACCAGCCGGGCCGGAG CAGTACAGACAAGGCAAAGTCCAGCTGCGGAGGTAG
AA sequence Show only first row Show all	>Lus10022354 pacid=23171777 polypeptide=Lus10022354 locus=Lus10022354.g ID=Lus10022354.BGIv1.0 annot-version=v1.0 MASSSKKVCPFDHVEGRTYNCRNCRLYIASEDQIFVNQAFQAANNGQADLFDRVSTMNVVYGDARQETIEGIEYGGRNAECAGCHSTIGWQYLYAPAGPE QYRQGKVQLRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G40110			Yippee family putative zinc-bi...		Lus10022354 [exp]	0	1

Compare expression of checked genes

Lus10022354 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.