Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027055 [exp] 44 / 3e-07 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G002300 [exp] 38 / 4e-05 ND / Potri.008G047850 [exp] 38 / 4e-05 AT3G57770 59 / 5e-12 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022366 pacid=23171734 polypeptide=Lus10022366 locus=Lus10022366.g ID=Lus10022366.BGIv1.0 annot-version=v1.0 ATGTGCAATGGAGGTCACTGGCCTAGACCACAAGCCTTCTTGATAGCTCGTAGATCCCGTCCAGGAATCCTAATTAGTATCAGCGACACAGAAGAACCAA GTATGAGCAACACAGTAAAAGCGACGCAGAAGAAATTAGACTGCAGTGATCAAAATCTGGCGCTACTGAACAGCATGAAGAAGAAGTTTGAAGTGGAAGA TTGGTGGGGTGCGCCAGGCCCTTGCAGCAGTGCAACGCATGGGCGACGCTTGAGACTTCCCTGA
AA sequence Show only first row Show all	>Lus10022366 pacid=23171734 polypeptide=Lus10022366 locus=Lus10022366.g ID=Lus10022366.BGIv1.0 annot-version=v1.0 MCNGGHWPRPQAFLIARRSRPGILISISDTEEPSMSNTVKATQKKLDCSDQNLALLNSMKKKFEVEDWWGAPGPCSSATHGRRLRLP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022366 [exp]	0	1
AT4G15620			Uncharacterised protein family...		Lus10035168 [exp]	3.9	0.7812
AT1G76140			Prolyl oligopeptidase family p...		Lus10021834 [exp]	12.2	0.6542
AT5G14870		ATCNGC18	cyclic nucleotide-gated channe...		Lus10039415 [exp]	12.4	0.6972
AT3G12660		FLA14	FASCICLIN-like arabinogalactan...		Lus10041630 [exp]	12.6	0.7044
AT5G44390			FAD-binding Berberine family p...		Lus10042382 [exp]	13.5	0.7410
					Lus10012495 [exp]	13.7	0.6963
AT1G07520	GRAS		GRAS family transcription fact...		Lus10037757 [exp]	16.6	0.7166
AT2G33530		SCPL46	serine carboxypeptidase-like 4...		Lus10040324 [exp]	23.6	0.7233
					Lus10001472 [exp]	27.1	0.6840
AT1G61720		BAN	BANYULS, NAD(P)-binding Rossma...		Lus10020072 [exp]	27.7	0.5795

Compare expression of checked genes

Lus10022366 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.