Lus10022367 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G66920 164 / 4e-48 Protein kinase superfamily protein (.1.2)
AT1G66930 164 / 5e-48 Protein kinase superfamily protein (.1)
AT1G66980 164 / 4e-47 GDPDL2, SNC4 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
AT1G66910 162 / 4e-47 Protein kinase superfamily protein (.1)
AT1G67000 162 / 2e-46 Protein kinase superfamily protein (.1)
AT1G70250 157 / 5e-45 receptor serine/threonine kinase, putative (.1)
AT5G38260 155 / 8e-45 Protein kinase superfamily protein (.1)
AT5G38280 155 / 1e-44 PR5K PR5-like receptor kinase (.1)
AT5G39030 154 / 7e-44 Protein kinase superfamily protein (.1)
AT4G18250 150 / 2e-42 receptor serine/threonine kinase, putative (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026759 266 / 1e-91 AT1G66930 196 / 5e-59 Protein kinase superfamily protein (.1)
Lus10022359 270 / 2e-88 AT1G66980 322 / 3e-101 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
Lus10025545 261 / 3e-88 AT5G39020 316 / 1e-101 Malectin/receptor-like protein kinase family protein (.1)
Lus10008335 269 / 7e-87 AT1G70250 316 / 8e-98 receptor serine/threonine kinase, putative (.1)
Lus10008362 262 / 4e-86 AT1G66930 250 / 7e-75 Protein kinase superfamily protein (.1)
Lus10025554 243 / 4e-79 AT5G38260 220 / 2e-64 Protein kinase superfamily protein (.1)
Lus10027013 221 / 7e-74 AT5G38280 195 / 3e-58 PR5-like receptor kinase (.1)
Lus10025492 223 / 8e-70 AT5G38260 326 / 1e-102 Protein kinase superfamily protein (.1)
Lus10014924 212 / 6e-66 AT1G67000 349 / 5e-112 Protein kinase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G122000 224 / 2e-73 AT5G38280 336 / 2e-110 PR5-like receptor kinase (.1)
Potri.017G034500 220 / 5e-72 AT5G38260 336 / 6e-111 Protein kinase superfamily protein (.1)
Potri.017G009600 224 / 7e-70 AT4G18250 323 / 1e-98 receptor serine/threonine kinase, putative (.1)
Potri.015G018600 222 / 8e-70 AT1G66920 351 / 9e-113 Protein kinase superfamily protein (.1.2)
Potri.007G125200 219 / 8e-70 AT5G38260 300 / 2e-94 Protein kinase superfamily protein (.1)
Potri.017G009100 223 / 1e-69 AT5G38280 331 / 1e-103 PR5-like receptor kinase (.1)
Potri.017G008800 221 / 8e-69 AT5G38280 330 / 1e-103 PR5-like receptor kinase (.1)
Potri.007G140800 213 / 5e-68 AT5G38280 333 / 1e-107 PR5-like receptor kinase (.1)
Potri.017G009000 209 / 5e-68 AT5G38280 306 / 3e-99 PR5-like receptor kinase (.1)
Potri.007G125000 218 / 6e-68 AT5G38260 318 / 7e-100 Protein kinase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence
>Lus10022367 pacid=23171697 polypeptide=Lus10022367 locus=Lus10022367.g ID=Lus10022367.BGIv1.0 annot-version=v1.0
ATGCCGATCAGGTACTCTTACTCAAACATCAAAAAGTTCACTGGCAGCTTCAAAGACAAGCTAGGCGAAGGCGGTTTCGGTTATGTTTACAAGGGTATGC
TCCGGAGTGGCAGTTTTGCAGCTGTAAAGATGCTTGGAAAGTCCACAGCTGGCGGAGTCCAAGACTTTATTAACGAAGTTGCAACCATTGGAACGATTCA
CCATGCTAATGTAGTAAGACTTATCGGCTTCTGTTCTAAAGGATCGAAGCGTGCTCTCGTTTACGAGATCATGCCAAACAGTTCCCTTGACAAATACATC
TTTCGCAAGCAACAAGGATATGTAACTTTGAGCATTGAACAACTGTATCGCATTTATCTTGGAGTGGCTCGTGGGATTGAATATCTGCACAGCGGGTGTG
CCTTGCAGATTCTGCATTTCGACATCAAGCCCCACAATGTTCTTCTTGCGACAACTTTAACCCGAAATTGTCGGACTTCGGGTTGGCTAGGTTTATGCAG
GTGA
AA sequence
>Lus10022367 pacid=23171697 polypeptide=Lus10022367 locus=Lus10022367.g ID=Lus10022367.BGIv1.0 annot-version=v1.0
MPIRYSYSNIKKFTGSFKDKLGEGGFGYVYKGMLRSGSFAAVKMLGKSTAGGVQDFINEVATIGTIHHANVVRLIGFCSKGSKRALVYEIMPNSSLDKYI
FRKQQGYVTLSIEQLYRIYLGVARGIEYLHSGCALQILHFDIKPHNVLLATTLTRNCRTSGWLGLCR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G66930 Protein kinase superfamily pro... Lus10022367 0 1
AT2G31140 Peptidase S24/S26A/S26B/S26C f... Lus10022921 2.4 0.8833
AT2G15490 UGT73B4 UDP-glycosyltransferase 73B4 (... Lus10019829 3.2 0.8548
AT5G62140 unknown protein Lus10038887 3.5 0.8739
AT3G62390 TBL6 TRICHOME BIREFRINGENCE-LIKE 6 ... Lus10017671 3.6 0.8360
AT3G58480 calmodulin-binding family prot... Lus10029323 4.4 0.8159
AT3G52270 Transcription initiation facto... Lus10030963 8.5 0.8240
AT3G25940 TFIIB zinc-binding protein (.1... Lus10015458 9.5 0.8778
AT1G76860 Small nuclear ribonucleoprotei... Lus10026326 9.9 0.8478
AT4G17085 Putative membrane lipoprotein ... Lus10029696 12.8 0.8041
AT3G23100 XRCC4 homolog of human DNA ligase iv... Lus10022210 13.4 0.8414

Lus10022367 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.