Lus10022369 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45360 40 / 0.0002 F-box family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007767 308 / 1e-109 AT5G45360 38 / 0.001 F-box family protein (.1)
Lus10037278 48 / 5e-07 AT5G45360 352 / 1e-121 F-box family protein (.1)
Lus10035689 48 / 5e-07 AT5G45360 351 / 6e-121 F-box family protein (.1)
Lus10039308 40 / 0.0003 AT5G52880 211 / 1e-67 F-box family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G236200 45 / 5e-06 AT5G45360 349 / 2e-120 F-box family protein (.1)
Potri.002G054500 41 / 0.0002 AT2G27310 122 / 2e-31 F-box family protein (.1)
Potri.008G204800 39 / 0.0007 AT4G15563 143 / 6e-43 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0271 F-box PF00646 F-box F-box domain
Representative CDS sequence
>Lus10022369 pacid=23171703 polypeptide=Lus10022369 locus=Lus10022369.g ID=Lus10022369.BGIv1.0 annot-version=v1.0
ATGGAAAGGCTACCTGCTGAACTCTGGCTCAAGATCTTCTGCTCCTTGGATCACCCAACTCTTGCTTCCGCCCAGCAAGTGTGCAAGAAATGGAAGGCAA
TTGGATCGGAGGATACTTTATGGTCCAATCTCTTCAATCAGAGATGGGGAACGGATCGTTCGGAATTCTACGCCCCGCTTGATTCCGGATCCTGGAAGGA
TGTTTATGCTGTTCAAGATCGTTGCGATCGAGTTGGATTGGGGCTGAAGATAATAAGAGAAGGTGGGGACTATTATCTGGTTCACCAGGGCGAAATCCAA
CGATATCTGGGTTCTCCCAGACAGAGAAAAGTCACAAATAAGGATGATGGCTCCCTGAAAGCTGAATCGTACATTGCCAATGGTGGTGGGAATGGGATCC
TGGACAAGATACTTTTCTTCATTGGAGACCTGGAAGTTGCATCTGCAGATGCCAAACGTGGTCGCCTGACATAA
AA sequence
>Lus10022369 pacid=23171703 polypeptide=Lus10022369 locus=Lus10022369.g ID=Lus10022369.BGIv1.0 annot-version=v1.0
MERLPAELWLKIFCSLDHPTLASAQQVCKKWKAIGSEDTLWSNLFNQRWGTDRSEFYAPLDSGSWKDVYAVQDRCDRVGLGLKIIREGGDYYLVHQGEIQ
RYLGSPRQRKVTNKDDGSLKAESYIANGGGNGILDKILFFIGDLEVASADAKRGRLT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G45360 F-box family protein (.1) Lus10022369 0 1
AT1G05410 Protein of unknown function (D... Lus10041201 1.4 0.9505
AT4G12610 RAP74, ATRAP74 transcription activators;DNA b... Lus10008686 4.7 0.9449
AT1G18470 Transmembrane Fragile-X-F-asso... Lus10032471 7.1 0.9361
AT4G36400 D2HGDH D-2-hydroxyglutarate dehydroge... Lus10028342 9.2 0.9271
AT4G33000 SCABP8, ATCBL10... SOS3-LIKE CALCIUM BINDING PROT... Lus10015630 11.2 0.9360
AT3G26100 Regulator of chromosome conden... Lus10006242 12.0 0.9402
AT3G03610 ELMO/CED-12 family protein (.1... Lus10009523 13.1 0.9339
AT1G04970 lipid-binding serum glycoprote... Lus10014625 13.5 0.9439
AT5G09850 Transcription elongation facto... Lus10002088 13.9 0.9308
AT3G15355 UBC25 ,PFU1 PHO2 FAMILY UBIQUITIN CONJUGAT... Lus10018596 16.2 0.9003

Lus10022369 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.