Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G21510 66 / 7e-14 F-box family protein (.1) AT1G61340 56 / 1e-10 F-box family protein (.1.2) AT4G35930 49 / 7e-08 F-box family protein (.1) AT4G05010 47 / 2e-07 F-box family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018432 [exp] 73 / 5e-17 AT4G21510 102 / 3e-27 F-box family protein (.1) Lus10011255 [exp] 72 / 1e-16 AT4G21510 114 / 1e-31 F-box family protein (.1) Lus10028422 [exp] 50 / 5e-08 AT4G35930 267 / 3e-89 F-box family protein (.1) Lus10041876 [exp] 50 / 7e-08 AT4G35930 265 / 3e-88 F-box family protein (.1) Lus10025956 [exp] 48 / 3e-07 AT4G35930 301 / 2e-102 F-box family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G042800 [exp] 63 / 3e-13 AT4G21510 115 / 4e-32 F-box family protein (.1) Potri.004G034400 [exp] 59 / 1e-11 AT1G61340 127 / 2e-37 F-box family protein (.1.2) Potri.005G110200 [exp] 49 / 1e-07 AT4G35930 332 / 4e-114 F-box family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022370 pacid=23171757 polypeptide=Lus10022370 locus=Lus10022370.g ID=Lus10022370.BGIv1.0 annot-version=v1.0 ATGGCGCAGGGGAAGAGGAGCGCGATTCGGTCTGGAATAAAGAGGAAGAGAGCCACCTGTGAAGAGGAGTCAGAGAAGAAGAAGAACCCTCATCATCTCC AGAAGTTGCCGGAGGAATTGCTCATAAAGGTCATCTGCGGAGTGAATTACGCGGATCTGAAGAATCTTCTCCTTGTATCGAGACAAATGGTGGGAGCTAC TCGGATCGCCAAGGAAATTCACTTCGACTACACCACTCCCGCTAAGGTTGAAGCTGAGCCGGAGATGGAGACGCTCCCAGCTGCTGCTGCTGCTCCTAGA GCCCTGATTCGCAAGAGGCTGACTGCGAAGGAAGCTTCGGATTTGTCGGTTACGCTGTTTCCTTCTTCTCAGTAG
AA sequence Show only first row Show all	>Lus10022370 pacid=23171757 polypeptide=Lus10022370 locus=Lus10022370.g ID=Lus10022370.BGIv1.0 annot-version=v1.0 MAQGKRSAIRSGIKRKRATCEEESEKKKNPHHLQKLPEELLIKVICGVNYADLKNLLLVSRQMVGATRIAKEIHFDYTTPAKVEAEPEMETLPAAAAAPR ALIRKRLTAKEASDLSVTLFPSSQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G21510			F-box family protein (.1)		Lus10022370 [exp]	0	1
AT4G32790			Exostosin family protein (.1)		Lus10043238 [exp]	1.4	0.8872
					Lus10024463 [exp]	2.8	0.8377
AT3G52420		ATOEP7	outer envelope membrane protei...		Lus10003733 [exp]	3.2	0.8862
AT1G67120			ATPases;nucleotide binding;ATP...		Lus10037615 [exp]	3.9	0.8713
AT4G03090			sequence-specific DNA binding;...		Lus10024746 [exp]	7.3	0.8375
AT5G38220			alpha/beta-Hydrolases superfam...		Lus10028497 [exp]	8.2	0.7929
AT3G05370		AtRLP31	receptor like protein 31 (.1)		Lus10019692 [exp]	8.4	0.8434
AT4G21190		EMB1417	embryo defective 1417, Pentatr...		Lus10039292 [exp]	8.7	0.8529
AT4G21760		BGLU47	beta-glucosidase 47 (.1)		Lus10032659 [exp]	10.2	0.8298
AT5G10250		DOT3	DEFECTIVELY ORGANIZED TRIBUTAR...		Lus10026046 [exp]	11.0	0.8443

Compare expression of checked genes

Lus10022370 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.