Lus10022378 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23710 290 / 1e-97 AtTic22-III translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
AT4G33350 152 / 2e-44 AtTic22-IV translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007784 434 / 4e-155 AT3G23710 257 / 2e-85 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Lus10006487 146 / 3e-42 AT4G33350 358 / 2e-125 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Lus10009759 140 / 2e-39 AT4G33350 355 / 3e-124 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G236000 333 / 7e-115 AT3G23710 351 / 7e-122 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Potri.014G030000 158 / 1e-46 AT4G33350 359 / 5e-126 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Potri.002G126800 157 / 3e-46 AT4G33350 374 / 7e-132 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04278 Tic22 Tic22-like family
Representative CDS sequence
>Lus10022378 pacid=23171689 polypeptide=Lus10022378 locus=Lus10022378.g ID=Lus10022378.BGIv1.0 annot-version=v1.0
ATGACTAGTTCCTCCGACCAACGGCGTCGCCACCTAGTAGAACTGGACCTCCGGGATGCCTTCTCCAAGCTCCAAACCCATTACTCCGCCTTCCTTAACA
ACTTCTCCCAGCTCCCTCTCTTCAATCCCAACGCCATCTCTTCTTTTCAAACCCACCTCCATTCCCAATTGCTTACCAGTTCTCAATCTCGCCCTCTCTG
GGCTCGGATTCCCTCTGACCCGTCTCTTCTCCAACTCTCCAAACCTCCCTCCGCCACCACTCCTCCTCCTTTGACCTCTCAAGCCATCGAGGCTCGGTTG
GCAGGCGTACCGGTTTATGCCCTCAGCAACTCCCGTGATGAGTTCGTTCTCGTCTCCGGAGTTTCTTCTTCCACTCCCAAGTCTCTCGGACTGATGTGCT
TCAAGAAAGAGGACGCCGATACTCTCCTTCTCCAGATGAAGAGCATGGACCCTCTCATGCGGAGCGGTGGCTCCAAAGTTGTTGCTGTTGCTTTGAACAA
GGTTTTTCAACTAAAAGTCGATGGGGTTTCCTTCAGGTTGATACCTGAGTATGCTCAAGTCAAGAACGCACTTAACGAGCTGAAAAATGCTGGGGTTTCT
GATGACGGGTTCCCTGGAGTTCCAGTTTTCCAGTCAACGAGTCTGGTGTTGAGAAGCAAAAACAAGAGCTATCGGCCAGTGTTCTTTAGAAAGGAGGATT
TAGAGAAATCACTATTACGTGCTTCACAAGATCAGAAGAAACTAAATCCTGCTTTAAAAGAAGGGGGCATTGAGGTGGCTGTGTTTGAAGACGTAATTAA
GTCCATGCAGGAAACATCGGCGTGGAATGATGTTGTTTTTATCCCTCCTGGGTTTGACGTCTCAACTGGTTCTGCCATGTTATAG
AA sequence
>Lus10022378 pacid=23171689 polypeptide=Lus10022378 locus=Lus10022378.g ID=Lus10022378.BGIv1.0 annot-version=v1.0
MTSSSDQRRRHLVELDLRDAFSKLQTHYSAFLNNFSQLPLFNPNAISSFQTHLHSQLLTSSQSRPLWARIPSDPSLLQLSKPPSATTPPPLTSQAIEARL
AGVPVYALSNSRDEFVLVSGVSSSTPKSLGLMCFKKEDADTLLLQMKSMDPLMRSGGSKVVAVALNKVFQLKVDGVSFRLIPEYAQVKNALNELKNAGVS
DDGFPGVPVFQSTSLVLRSKNKSYRPVFFRKEDLEKSLLRASQDQKKLNPALKEGGIEVAVFEDVIKSMQETSAWNDVVFIPPGFDVSTGSAML

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23710 AtTic22-III translocon at the inner envelo... Lus10022378 0 1
AT1G34160 Tetratricopeptide repeat (TPR)... Lus10004197 3.5 0.8080
AT4G26780 MGE2, AR192 mitochondrial GrpE 2, Co-chape... Lus10032565 3.9 0.8057
AT5G25190 AP2_ERF ESE3 ethylene and salt inducible 3,... Lus10035859 3.9 0.8089
AT5G66520 Tetratricopeptide repeat (TPR)... Lus10038396 4.5 0.8288
AT1G34160 Tetratricopeptide repeat (TPR)... Lus10029401 4.7 0.8330
Lus10015575 6.4 0.7211
AT5G47520 AtRABA5a RAB GTPase homolog A5A (.1) Lus10038807 6.5 0.7465
AT3G63090 Ubiquitin carboxyl-terminal hy... Lus10028012 6.9 0.7141
AT5G09760 Plant invertase/pectin methyle... Lus10013721 7.4 0.7928
AT1G72210 bHLH bHLH096 basic helix-loop-helix (bHLH) ... Lus10029950 8.9 0.7990

Lus10022378 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.