Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10810 44 / 4e-07 unknown protein AT4G24026 40 / 7e-06 unknown protein AT4G24030 40 / 3e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007785 [exp] 81 / 7e-21 ND 56 / 4e-11 Lus10012620 [exp] 43 / 8e-07 AT4G10810 62 / 2e-14 unknown protein Lus10010114 [exp] 43 / 4e-06 AT4G10810 63 / 5e-13 unknown protein Lus10023038 [exp] 37 / 0.0003 AT4G10810 67 / 3e-16 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G173700 [exp] 43 / 9e-07 AT4G10810 69 / 8e-17 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022380 pacid=23171735 polypeptide=Lus10022380 locus=Lus10022380.g ID=Lus10022380.BGIv1.0 annot-version=v1.0 ATGGAAGGCGCAGGAGCGTGCTGGTCGTACGAGAAGCTGAAATGGGTAGGGACGAGTATGGCATCCGCTTTCTTCACATCTTTGGAACGATGTTCCTGTA TTAACCTCCCCGTCTCCGACGACGCTGACGACGAAGACGAGGCCCAGGATCGCCCTCTGATGTTCTCCAATTCGATCTCGAATTCTTCCTTCTCTTCCTC CCTGTCATCCTCTCCGATCTCCACCGATCCCCCTAGCGGTGCTGGCTCCGTCCGTGCCTGA
AA sequence Show only first row Show all	>Lus10022380 pacid=23171735 polypeptide=Lus10022380 locus=Lus10022380.g ID=Lus10022380.BGIv1.0 annot-version=v1.0 MEGAGACWSYEKLKWVGTSMASAFFTSLERCSCINLPVSDDADDEDEAQDRPLMFSNSISNSSFSSSLSSSPISTDPPSGAGSVRA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G10810			unknown protein		Lus10022380 [exp]	0	1
AT5G27990			Pre-rRNA-processing protein TS...		Lus10006795 [exp]	6.9	0.7689
AT3G45210			Protein of unknown function, D...		Lus10000724 [exp]	8.5	0.7470
AT5G07900			Mitochondrial transcription te...		Lus10008688 [exp]	11.5	0.7054
AT3G04470			Ankyrin repeat family protein ...		Lus10029612 [exp]	13.2	0.7134
AT4G02100			Heat shock protein DnaJ with t...		Lus10002438 [exp]	13.5	0.7286
AT5G67070		RALFL34	ralf-like 34 (.1)		Lus10003931 [exp]	24.6	0.6945
AT1G27435			unknown protein		Lus10012558 [exp]	24.7	0.6619
AT5G55670			RNA-binding (RRM/RBD/RNP motif...		Lus10038758 [exp]	24.7	0.6936
AT5G18110		NCBP	novel cap-binding protein (.1)		Lus10020282 [exp]	26.3	0.6753
AT2G47450		CPSRP43, CAO	CHLOROPLAST SIGNAL RECOGNITION...		Lus10025111 [exp]	27.7	0.6616

Compare expression of checked genes

Lus10022380 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.