Lus10022395 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G04950 92 / 5e-24 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000934 124 / 6e-35 AT3G04950 256 / 8e-84 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G034100 104 / 7e-29 AT3G04950 290 / 3e-100 unknown protein
PFAM info
Representative CDS sequence
>Lus10022395 pacid=23171740 polypeptide=Lus10022395 locus=Lus10022395.g ID=Lus10022395.BGIv1.0 annot-version=v1.0
ATGGAGGCCGTGATTCGGTATCTCAGCACGTTTGACGATACCAGAGAGGTTTGGTTTACTCAAAAGTTTGAATTTTTAATTTCAGTAGTGATTGGAAACC
ATAGGGATATGTTGAATCTTCAAACGAGCCAAAAGCAAGCAGCGGCGAAGCACTGCAATTGCACTACAGCTGAGGTCGATAGCGCTTTGGCGAAGTTCAT
TTGGGCTAAACAAGCGCATGCTAAGCTTGATAAGATGGAGGAAGAAGGAAGGCCGATGCTCAAGAGCTTAGCTGAGGTGCAGAAACTTATAAGGAACCCG
CCGATGGATCTTGAATCAATGTCATTGGATCCAAGGGTGGGGAAAAGTTTATAG
AA sequence
>Lus10022395 pacid=23171740 polypeptide=Lus10022395 locus=Lus10022395.g ID=Lus10022395.BGIv1.0 annot-version=v1.0
MEAVIRYLSTFDDTREVWFTQKFEFLISVVIGNHRDMLNLQTSQKQAAAKHCNCTTAEVDSALAKFIWAKQAHAKLDKMEEEGRPMLKSLAEVQKLIRNP
PMDLESMSLDPRVGKSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G04950 unknown protein Lus10022395 0 1
AT2G06090 Plant self-incompatibility pro... Lus10023196 3.0 0.6897
AT1G64160 Disease resistance-responsive ... Lus10028749 7.2 0.6180
Lus10042500 10.7 0.6161
AT1G77980 MADS AGL66 AGAMOUS-like 66 (.1) Lus10018493 11.0 0.6367
AT1G10200 LIM WLIM1, SF3 WLIM1, GATA type zinc finger t... Lus10027305 17.0 0.6096
Lus10011637 17.5 0.6308
AT5G42540 AtXRN2, XRN2 exoribonuclease 2 (.1.2) Lus10009577 19.2 0.6172
Lus10023538 27.5 0.5771
AT4G35150 O-methyltransferase family pro... Lus10012408 28.3 0.6047
AT3G10660 ATCPK2, CPK2 calmodulin-domain protein kina... Lus10016190 30.2 0.6026

Lus10022395 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.