Lus10022409 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64620 142 / 2e-43 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
AT4G15750 43 / 3e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G48010 42 / 9e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038738 51 / 5e-08 AT5G64620 67 / 4e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10039120 49 / 2e-07 AT5G64620 69 / 5e-15 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10016317 46 / 3e-06 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10002738 44 / 1e-05 AT1G47960 67 / 5e-14 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10037791 43 / 3e-05 AT3G17130 131 / 8e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10000822 42 / 6e-05 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017347 42 / 8e-05 AT3G17220 81 / 2e-19 pectin methylesterase inhibitor 2 (.1)
Lus10037792 40 / 0.0005 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10027947 40 / 0.0005 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G108301 181 / 3e-58 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.010G209800 73 / 3e-16 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.001G127500 61 / 9e-12 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.009G083500 58 / 1e-10 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.006G134900 55 / 1e-09 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.016G001600 53 / 1e-08 AT5G64620 82 / 9e-20 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.008G013400 52 / 3e-08 AT5G64620 66 / 8e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.003G086500 46 / 3e-06 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.010G063000 43 / 3e-05 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.003G086600 41 / 0.0001 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10022409 pacid=23171680 polypeptide=Lus10022409 locus=Lus10022409.g ID=Lus10022409.BGIv1.0 annot-version=v1.0
ATGGATAACTCCACCATTTGGGCCGTACTCTCCATCCTCCTCATCTCGCCGTTGGCCGGAGCCGACACAAGCTTGATCCAAAAGACGTGCAAATCCACTA
AACACTACGACCTCTGCCTCTCCTCTCTTAACTCCAACTCCACCAGCTCAACCGCCGACATCAAGGGACTTGCCCTTATCATGATCGGCTTCGGGATGGC
CAATGCCACCGCCACCTCCACTTACCTGTCCTCCCAGCTCGCCGCTGCCGGCACCTCGAACACTAACAACGACCCAGCAGCAGCTCTGAAGAAGGCGGTG
CTGAAGGAGTGTGCCGATAAGTACATGTACGCCGGCGAAGCGCTACAAAGCTCAGCTGAAGATTTGGGGATTGAAGATTACGATTACGCCTCCATCCACG
TGACAGCGGCCGCCGATTATCCGAATGCGTGTCGTAACGCGTTTCGGAGGAACTCGGGCCGGCTGGTTTACCCGCCGGAGCTTGCTCGAAGGGAAGATGG
GCTGAAGCGGATCTGTGATGTTGTTTTGCAGATGATTGATCTTCTTATTGCTAACTAA
AA sequence
>Lus10022409 pacid=23171680 polypeptide=Lus10022409 locus=Lus10022409.g ID=Lus10022409.BGIv1.0 annot-version=v1.0
MDNSTIWAVLSILLISPLAGADTSLIQKTCKSTKHYDLCLSSLNSNSTSSTADIKGLALIMIGFGMANATATSTYLSSQLAAAGTSNTNNDPAAALKKAV
LKECADKYMYAGEALQSSAEDLGIEDYDYASIHVTAAADYPNACRNAFRRNSGRLVYPPELARREDGLKRICDVVLQMIDLLIAN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64620 ATC/VIF2, C/VIF... cell wall / vacuolar inhibitor... Lus10022409 0 1
AT5G66580 unknown protein Lus10000739 2.4 0.8342
AT4G28100 unknown protein Lus10018524 4.2 0.8572
AT1G69560 MYB LOF2, ATMYB105 LATERAL ORGAN FUSION 2, myb do... Lus10026611 9.8 0.8556
AT2G30620 winged-helix DNA-binding trans... Lus10006561 10.2 0.8331
AT4G39955 alpha/beta-Hydrolases superfam... Lus10000630 11.1 0.8547
AT3G06270 Protein phosphatase 2C family ... Lus10021952 13.3 0.8326
AT1G69560 MYB LOF2, ATMYB105 LATERAL ORGAN FUSION 2, myb do... Lus10030452 13.5 0.8616
AT2G46660 CYP78A6 "cytochrome P450, family 78, s... Lus10001670 24.8 0.7788
AT3G18800 unknown protein Lus10033505 25.4 0.8512
AT4G02340 alpha/beta-Hydrolases superfam... Lus10026140 30.0 0.7857

Lus10022409 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.