Lus10022415 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06620 433 / 5e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59530 411 / 2e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59540 404 / 1e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G04350 401 / 1e-139 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G30840 394 / 2e-136 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06650 393 / 4e-136 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G06640 392 / 8e-136 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT2G30830 389 / 6e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G43440 387 / 4e-134 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT5G43450 376 / 1e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022195 614 / 0 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027585 612 / 0 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021203 570 / 0 AT1G06620 416 / 2e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022196 561 / 0 AT5G59530 420 / 5e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021943 487 / 3e-173 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022193 476 / 4e-169 AT1G06620 455 / 1e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022191 473 / 1e-167 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027586 473 / 1e-167 AT1G06620 449 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10037796 471 / 4e-167 AT1G06620 442 / 4e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G073300 456 / 3e-161 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073166 443 / 4e-156 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073232 427 / 9e-150 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.008G165400 396 / 2e-137 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G156200 381 / 1e-131 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.010G073100 379 / 1e-130 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.017G135800 338 / 2e-114 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.013G045000 332 / 3e-112 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G222300 325 / 2e-109 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.002G040700 314 / 3e-105 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10022415 pacid=23171786 polypeptide=Lus10022415 locus=Lus10022415.g ID=Lus10022415.BGIv1.0 annot-version=v1.0
ATGGCAGCAGCTTACGATAGGCTGGCTGAATTGAAGGCATTCGACGAAACCAAAGCCGGAGTCAAAGGCCTAGTCGACGCTGGAGTGACTGAGCTCCCTC
GTATCTTCAAGGCACCACCTCATCTTCTTCTAGACAACAACAGCAACATTAAGAAATCGCCAACTAATGTCTCTCCCCAAGATCAGGACTTCATTTTCCC
AACCATAGACCTGCAAGGTTTGGCGGCCCAAGACCACCCCGAGAAGCGAAAGCAGATTGTTCAGAAAGTGAAAGAAGCATCTTCCAACTGGGGATTTTTC
CAGGTGGTTAATCACGGAATTCCACTGAGCGTGTTGGATGAGATGAAGGCCGGGACTCGCAGGTTTCACGAGCAGGATGTCGAGGTGAAGAAGCAATTCT
ATACTCGTGACGTTGTTAACACAAAGATCATTTACAACAGCAACTTCGACCTCTACACCGGAGCTTTTACCAACTGGAGGGACACTCTTCTCATTCATAT
TGCTCCCGATCCAGCTCCCTCCCCCGATGAATATCCCGCTTGTTGCAGAGAAATACTACTGGAATATTCAAAAGTAGTGGCAAAACTCGGAGACTTGCTT
TTCCAACTATTGTCGGAGGCTCTGGGGTTAGATTCGGACCGTCTGAAAAAACTGCAATGCACAAAGGGACTCAACGTGGCATGCCATTACTATCCGGCAT
GTCCACAGCCAGAACTGACGATGGGAGCATGCAAGCATGCTGACAATGATTTCATTACGGTGCTTCTTCAAGACCATTGTGGAGGCCTCCAAGTTCTTCA
CAAGGACCAATGGGTTGATATCCCTCCCATTCCTGATGCTTTAGTGGTCAACATCGGAGATTTACTCCAGCTGATATCCAACGACAAATTTATAAGTTCA
GAGCATAGAGTGATATCACAAAATGTTGGGCCAAGAGTATCTGTTGGATGCTTCTTCAATACTGGGTTTTCAGGGTATCCAATTAATATTGGACCCATCG
CGGAGCTGTTATCGGAAAATGAGCCTCCGAAATATAGGCAGACCACGGTGGCCGAGTTTAGTACTCACTTCTTCAGTAAAGGCCTTCATGGCACTTCTGC
GTTGCTTCATTTCAAGCTCTGA
AA sequence
>Lus10022415 pacid=23171786 polypeptide=Lus10022415 locus=Lus10022415.g ID=Lus10022415.BGIv1.0 annot-version=v1.0
MAAAYDRLAELKAFDETKAGVKGLVDAGVTELPRIFKAPPHLLLDNNSNIKKSPTNVSPQDQDFIFPTIDLQGLAAQDHPEKRKQIVQKVKEASSNWGFF
QVVNHGIPLSVLDEMKAGTRRFHEQDVEVKKQFYTRDVVNTKIIYNSNFDLYTGAFTNWRDTLLIHIAPDPAPSPDEYPACCREILLEYSKVVAKLGDLL
FQLLSEALGLDSDRLKKLQCTKGLNVACHYYPACPQPELTMGACKHADNDFITVLLQDHCGGLQVLHKDQWVDIPPIPDALVVNIGDLLQLISNDKFISS
EHRVISQNVGPRVSVGCFFNTGFSGYPINIGPIAELLSENEPPKYRQTTVAEFSTHFFSKGLHGTSALLHFKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10022415 0 1
AT1G10340 Ankyrin repeat family protein ... Lus10038609 3.3 0.8471
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Lus10026629 8.6 0.8191
AT5G48380 BIR1 BAK1-interacting receptor-like... Lus10037226 9.2 0.7919
AT4G12010 Disease resistance protein (TI... Lus10015350 9.9 0.7773
AT3G51550 FER FERONIA, Malectin/receptor-lik... Lus10029946 11.5 0.7909
AT3G54040 PAR1 protein (.1) Lus10017196 12.5 0.7695
AT1G10340 Ankyrin repeat family protein ... Lus10038608 14.5 0.7857
AT2G46150 Late embryogenesis abundant (L... Lus10017531 15.2 0.7742
AT5G05190 Protein of unknown function (D... Lus10034250 17.0 0.7294
AT1G28520 VOZ ATVOZ1, VOZ1 vascular plant one zinc finger... Lus10005274 19.1 0.7524

Lus10022415 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.