Lus10022428 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01630 309 / 5e-107 Sec14p-like phosphatidylinositol transfer family protein (.1)
AT1G14820 137 / 2e-39 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
AT1G75170 101 / 2e-25 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
AT4G36640 99 / 1e-24 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
AT4G08690 97 / 1e-23 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
AT1G22180 88 / 3e-20 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
AT4G09160 86 / 7e-19 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein (.1)
AT5G63060 78 / 4e-17 Sec14p-like phosphatidylinositol transfer family protein (.1)
AT4G39180 74 / 4e-15 ATSEC14, SEC14 ARABIDOPSIS THALIANA SECRETION 14, Sec14p-like phosphatidylinositol transfer family protein (.1.2)
AT2G16380 74 / 5e-15 Sec14p-like phosphatidylinositol transfer family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016733 462 / 1e-167 AT1G01630 325 / 2e-113 Sec14p-like phosphatidylinositol transfer family protein (.1)
Lus10004684 337 / 5e-118 AT1G01630 326 / 2e-113 Sec14p-like phosphatidylinositol transfer family protein (.1)
Lus10040252 334 / 1e-116 AT1G01630 319 / 8e-111 Sec14p-like phosphatidylinositol transfer family protein (.1)
Lus10001584 153 / 7e-46 AT1G14820 320 / 2e-111 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Lus10003699 149 / 5e-44 AT1G14820 316 / 1e-109 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Lus10034577 128 / 2e-36 AT1G14820 257 / 3e-87 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Lus10026020 94 / 3e-22 AT1G75170 397 / 4e-139 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Lus10010804 91 / 1e-21 AT1G75170 393 / 7e-139 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Lus10014312 91 / 2e-21 AT1G75170 397 / 4e-140 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G063966 314 / 1e-108 AT1G01630 340 / 2e-118 Sec14p-like phosphatidylinositol transfer family protein (.1)
Potri.001G068000 304 / 5e-105 AT1G01630 361 / 3e-127 Sec14p-like phosphatidylinositol transfer family protein (.1)
Potri.003G162100 302 / 3e-104 AT1G01630 356 / 2e-125 Sec14p-like phosphatidylinositol transfer family protein (.1)
Potri.008G135600 155 / 2e-46 AT1G14820 323 / 2e-112 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Potri.010G105400 143 / 5e-42 AT1G14820 326 / 1e-113 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Potri.015G023000 142 / 2e-41 AT1G14820 276 / 5e-94 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Potri.007G025800 99 / 3e-24 AT1G75170 408 / 2e-144 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Potri.005G123200 96 / 3e-23 AT1G75170 414 / 9e-147 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Potri.007G025900 95 / 4e-23 AT1G75170 369 / 3e-129 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Potri.013G068700 91 / 3e-21 AT1G22180 351 / 6e-121 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0214 UBA PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
CL0512 CRAL_TRIO PF00650 CRAL_TRIO CRAL/TRIO domain
Representative CDS sequence
>Lus10022428 pacid=23171726 polypeptide=Lus10022428 locus=Lus10022428.g ID=Lus10022428.BGIv1.0 annot-version=v1.0
ATGTCCCGTAATGGCGATCAACCATCAGATCCAGATGACAAGCTTGAAATTGAGCGGACCAAATTGAGACTCTTGAGGGACTTGGTCCAGACGAAGGATC
CTTCTTCCAAGGAAGTAGATGATGGGACACTGAGGAGGTTTCTGAGAGCGAGGGATATGGACGTAGAGAACGCATGTGCAATGTTCCTCAAATACCTCAA
CTGGAAGCACAGTTTCATCCCCAATGGCACCTCCTCTGTTTCCACATCCGACATCTCCACCGACATTTCCCACAACAAGGTGTTCCTCCAAGGTACTGAT
CGGACTGGCCGACCCATCTCCGTTGCTTTCGGAAGTCGCCATTTCCAGAACGGCGTTGACGAATTCAAGCGTTATGTAGTTTATGTCATCGAGAAACTCT
GCGCAAGTATGGCGGAAGGACAAGAGAAATTTGTGGTGATCGGAGATCTGGAAGGTTGGGGTTATGCAAACAGCGACGTTAGGGGTTATCTGGCTGCTCT
GCACATTTTGCAGGATTACTACCCAGAAAGACTTGGGAAGCTGTTCATTGTGAATGTGCCATACATTTTCATGGCAGTGTGGAAAGTTATTTACCCCTTA
ATCGACAGCAATACCAAAAGAAAGATTGTATTTGTGGATAACAAGAAGCTGAAATCCACACTTGTAGAGGACATTGATGAAAGCCAGCTGCCAGAGATAT
ACGGAGGCAAACTGCCTTTAGTTCCTATCCACCTCACCTGA
AA sequence
>Lus10022428 pacid=23171726 polypeptide=Lus10022428 locus=Lus10022428.g ID=Lus10022428.BGIv1.0 annot-version=v1.0
MSRNGDQPSDPDDKLEIERTKLRLLRDLVQTKDPSSKEVDDGTLRRFLRARDMDVENACAMFLKYLNWKHSFIPNGTSSVSTSDISTDISHNKVFLQGTD
RTGRPISVAFGSRHFQNGVDEFKRYVVYVIEKLCASMAEGQEKFVVIGDLEGWGYANSDVRGYLAALHILQDYYPERLGKLFIVNVPYIFMAVWKVIYPL
IDSNTKRKIVFVDNKKLKSTLVEDIDESQLPEIYGGKLPLVPIHLT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G01630 Sec14p-like phosphatidylinosit... Lus10022428 0 1
AT3G46010 ATADF1, ADF1 actin depolymerizing factor 1 ... Lus10024417 3.6 0.8315
AT4G39220 ATRER1A Rer1 family protein (.1) Lus10041765 4.5 0.8068
AT3G10300 Calcium-binding EF-hand family... Lus10018041 5.5 0.8180
AT5G44670 Domain of unknown function (DU... Lus10008076 5.8 0.8197
AT3G10300 Calcium-binding EF-hand family... Lus10042037 9.2 0.8053
AT3G49720 unknown protein Lus10039648 9.2 0.8169
AT3G61260 Remorin family protein (.1) Lus10018840 9.5 0.8001
AT3G22550 Protein of unknown function (D... Lus10025770 9.5 0.7900
AT4G39220 ATRER1A Rer1 family protein (.1) Lus10028317 10.4 0.7752
AT4G17100 unknown protein Lus10001086 10.7 0.7894

Lus10022428 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.