Lus10022430 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G51010 160 / 5e-51 Rubredoxin-like superfamily protein (.1)
AT5G17170 50 / 8e-08 ENH1 enhancer of sos3-1, rubredoxin family protein (.1.2)
AT1G54500 41 / 0.0001 Rubredoxin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016735 246 / 1e-84 AT5G51010 189 / 3e-62 Rubredoxin-like superfamily protein (.1)
Lus10027889 95 / 7e-26 AT5G51010 102 / 2e-29 Rubredoxin-like superfamily protein (.1)
Lus10003157 52 / 3e-08 AT5G17170 377 / 3e-133 enhancer of sos3-1, rubredoxin family protein (.1.2)
Lus10002349 52 / 4e-08 AT5G17170 360 / 5e-126 enhancer of sos3-1, rubredoxin family protein (.1.2)
Lus10015945 45 / 3e-06 AT1G54500 182 / 2e-58 Rubredoxin-like superfamily protein (.1)
Lus10019005 45 / 4e-06 AT1G54500 188 / 1e-60 Rubredoxin-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G108100 154 / 2e-48 AT5G51010 160 / 5e-51 Rubredoxin-like superfamily protein (.1)
Potri.019G042600 48 / 6e-07 AT5G17170 301 / 3e-103 enhancer of sos3-1, rubredoxin family protein (.1.2)
Potri.013G035700 44 / 1e-05 AT1G54500 197 / 2e-64 Rubredoxin-like superfamily protein (.1)
Potri.005G049000 39 / 0.0006 AT1G54500 184 / 3e-59 Rubredoxin-like superfamily protein (.1)
Potri.012G109700 0 / 1 AT5G51010 0 / 1 Rubredoxin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0045 Rubredoxin PF00301 Rubredoxin Rubredoxin
Representative CDS sequence
>Lus10022430 pacid=23171706 polypeptide=Lus10022430 locus=Lus10022430.g ID=Lus10022430.BGIv1.0 annot-version=v1.0
ATGGCGGTGCATCTACAAGCAACAACGGTAACAAGTAGAAGGCTTAATGGCTCTGAACCCCCTCAGCATCTGTTTGCTGCTCTAAAATCATCCTTCTTCT
CTCCTTCACTCAACTTGTTACCAGCAGTATCCCGACAACGCCGTCGTCCCCTTTCTGCTTCCACGGCTCCCCAAATCTGCATGCGCCTCGCCTCCAAGCA
AGCTTACATTTGCCGGGACTGCGGGTACATTTACAACGACAGAACTCCCTTCGACAAACTCCCTGACAACTACTTCTGCCCTGTTTGTGGTGCATCCAAG
AGAAGATTCAGAGCTTACACCCCAGCAGTCACCAAGAATGCCAATGAGAAGGATGCTAGGAAAGCACGCAAAGCTGAACTACAGAGAGACGAGGCTATTG
GGCGAGCTTTGCCAATTGCTGTAGTGGTTGGACTTGCCATCCTCGCTGCAATATACTTCTATCTCAACACTACCTTCCAAACCTAA
AA sequence
>Lus10022430 pacid=23171706 polypeptide=Lus10022430 locus=Lus10022430.g ID=Lus10022430.BGIv1.0 annot-version=v1.0
MAVHLQATTVTSRRLNGSEPPQHLFAALKSSFFSPSLNLLPAVSRQRRRPLSASTAPQICMRLASKQAYICRDCGYIYNDRTPFDKLPDNYFCPVCGASK
RRFRAYTPAVTKNANEKDARKARKAELQRDEAIGRALPIAVVVGLAILAAIYFYLNTTFQT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G51010 Rubredoxin-like superfamily pr... Lus10022430 0 1
AT1G09310 Protein of unknown function, D... Lus10018630 1.0 0.8435
AT1G61110 NAC ANAC025 NAC domain containing protein ... Lus10011215 4.9 0.8052
AT4G38690 PLC-like phosphodiesterases su... Lus10025062 5.3 0.7965
AT2G40830 RHC1A RING-H2 finger C1A (.1.2.3) Lus10001582 11.5 0.7797
AT4G28760 Protein of unknown function (D... Lus10022842 13.5 0.7652
AT1G01630 Sec14p-like phosphatidylinosit... Lus10022428 15.0 0.7748
AT1G11090 alpha/beta-Hydrolases superfam... Lus10018466 15.9 0.8145
AT3G18280 Bifunctional inhibitor/lipid-t... Lus10033574 19.1 0.7954
AT1G26355 SP1L1 SPIRAL1-like1 (.1) Lus10036916 20.8 0.7504
AT4G15930 Dynein light chain type 1 fami... Lus10006500 21.6 0.7651

Lus10022430 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.