Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50810 109 / 4e-33 TIM8 translocase inner membrane subunit 8 (.1) AT1G61570 40 / 1e-05 TIM13 translocase of the inner mitochondrial membrane 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017352 [exp] 35 / 0.0009 AT1G61570 92 / 6e-26 translocase of the inner mitochondrial membrane 13 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G103400 [exp] 111 / 4e-34 AT5G50810 95 / 2e-27 translocase inner membrane subunit 8 (.1) Potri.015G102000 [exp] 107 / 3e-32 AT5G50810 96 / 7e-28 translocase inner membrane subunit 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02953 [flax] [poplar] zf-Tim10_DDP Tim10/DDP family zinc finger
Representative CDS sequence Show only first row Show all	>Lus10022450 pacid=23171690 polypeptide=Lus10022450 locus=Lus10022450.g ID=Lus10022450.BGIv1.0 annot-version=v1.0 ATGGATCCTTCATCGCTTAATTCCCCTGAAATGCAGCATTTTCTCAACCAAGAAAAGGAAAGAGCAATGATGAATGAGATGGTGGCGAAGCTGACTAATG TGTGCTGGGATAAGTGCATTACTAGCACACCTGGAAACAAGTTTAGCTCAGGTGAAGCAGCTTGCCTTTCCAATTGTGCTCAACGTTATTTGGATTTGAG CGTAATCATCATGAAACGTTTCCAGTCCATGCAGTGA
AA sequence Show only first row Show all	>Lus10022450 pacid=23171690 polypeptide=Lus10022450 locus=Lus10022450.g ID=Lus10022450.BGIv1.0 annot-version=v1.0 MDPSSLNSPEMQHFLNQEKERAMMNEMVAKLTNVCWDKCITSTPGNKFSSGEAACLSNCAQRYLDLSVIIMKRFQSMQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G50810		TIM8	translocase inner membrane sub...		Lus10022450 [exp]	0	1
AT2G20450			Ribosomal protein L14 (.1)		Lus10008246 [exp]	1.0	0.9601
AT4G29430		RPS15AE	ribosomal protein S15A E (.1)		Lus10000975 [exp]	1.4	0.9355
AT5G56670			Ribosomal protein S30 family p...		Lus10017473 [exp]	3.9	0.9229
AT3G49100			Signal recognition particle, S...		Lus10018775 [exp]	3.9	0.9095
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10023730 [exp]	5.5	0.9326
AT3G18760			Translation elongation factor...		Lus10006729 [exp]	5.8	0.9070
AT5G40080			Mitochondrial ribosomal protei...		Lus10003002 [exp]	6.0	0.9145
AT3G11500			Small nuclear ribonucleoprotei...		Lus10017019 [exp]	7.7	0.9129
AT2G24830	C3HZnF		zinc finger (CCCH-type) family...		Lus10026901 [exp]	10.0	0.8422
AT3G11500			Small nuclear ribonucleoprotei...		Lus10021342 [exp]	10.6	0.9101

Compare expression of checked genes

Lus10022450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.