Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66590 189 / 9e-62 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 125 / 3e-36 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT1G01310 125 / 7e-36 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G31470 123 / 1e-35 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G57625 122 / 4e-35 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33720 116 / 2e-33 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14610 114 / 2e-32 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT3G19690 108 / 2e-30 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25780 107 / 2e-29 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14580 104 / 7e-29 ATPRB1 basic pathogenesis-related protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016787 [exp] 303 / 1e-106 AT5G66590 187 / 7e-61 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10020491 [exp] 130 / 1e-38 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1) Lus10020493 [exp] 118 / 5e-34 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1) Lus10005557 [exp] 118 / 6e-34 AT4G31470 199 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10012479 [exp] 118 / 6e-34 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1) Lus10013693 [exp] 115 / 1e-32 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10020481 [exp] 115 / 1e-32 AT2G14610 176 / 6e-57 pathogenesis-related gene 1 (.1) Lus10020480 [exp] 110 / 9e-31 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10009068 [exp] 107 / 1e-29 AT3G09590 149 / 1e-45 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G130100 [exp] 207 / 6e-69 AT5G66590 196 / 3e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.007G033200 [exp] 202 / 1e-66 AT5G66590 192 / 4e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083300 [exp] 124 / 2e-36 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083100 [exp] 124 / 2e-36 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 121 / 2e-35 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096007 [exp] 121 / 3e-35 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082900 [exp] 117 / 2e-33 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.006G171300 [exp] 114 / 2e-32 AT4G30320 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288301 [exp] 105 / 5e-29 AT2G14580 202 / 1e-67 basic pathogenesis-related protein 1 (.1) Potri.001G288401 [exp] 102 / 8e-28 AT2G14610 178 / 4e-58 pathogenesis-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10022481 pacid=23171679 polypeptide=Lus10022481 locus=Lus10022481.g ID=Lus10022481.BGIv1.0 annot-version=v1.0 ATGGCTTCTTCCACAATCACCATCCTCATCCCTCTTCTTCTGATGATTATCCTCGCCTTATCCAACGTCTCCGCCAAAACACCGCCACCGTCGCTGACAA CAGATGCTAGAGAGTTTCTGGAAGCACACAATCAAGCGAGAGGTGTCGTAGGAGTAGGTCCTCTAACCTGGAACCAGTCTCTTATGGCCGCCGCCAGTAG GACGGCGAGGATGCAGAGGGACAAACTGAAGTGCGAGTTTGCCAACCTGACAAACAGCAAATACGGAGGAAATCAGATGTGGGCCAGCGGAAGCGGGGTG ACACCGAGGATGGTGGTGGACAGCTGGGTGGCGGAGAAGAAGTACTACGACCACCGCAGGAACACGTGTAAGGCGGGGCACATGTGCGGGGTTTACACGC AGGTGGTGTGGAGAAAGTCCAAGGAACTGGGCTGCGCCTCTGCCACGTGTAAAGAGGAGGGATCCGGCGGCGGCACCTTGACAATTTGCTTCTACAACCC TCCTGGAAATTTCGTCGGCGAGGCCCCTTACTGA
AA sequence Show only first row Show all	>Lus10022481 pacid=23171679 polypeptide=Lus10022481 locus=Lus10022481.g ID=Lus10022481.BGIv1.0 annot-version=v1.0 MASSTITILIPLLLMIILALSNVSAKTPPPSLTTDAREFLEAHNQARGVVGVGPLTWNQSLMAAASRTARMQRDKLKCEFANLTNSKYGGNQMWASGSGV TPRMVVDSWVAEKKYYDHRRNTCKAGHMCGVYTQVVWRKSKELGCASATCKEEGSGGGTLTICFYNPPGNFVGEAPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66590			CAP (Cysteine-rich secretory p...		Lus10022481 [exp]	0	1
AT1G25400			unknown protein		Lus10034335 [exp]	2.0	0.8468
AT1G11360			Adenine nucleotide alpha hydro...		Lus10018515 [exp]	4.9	0.8247
AT4G26470			Calcium-binding EF-hand family...		Lus10008357 [exp]	5.2	0.8437
AT1G10650			SBP (S-ribonuclease binding pr...		Lus10030599 [exp]	7.9	0.8507
AT3G10330			Cyclin-like family protein (.1...		Lus10035440 [exp]	8.1	0.8139
AT5G14890			NHL domain-containing protein ...		Lus10033413 [exp]	8.4	0.8243
AT4G39660		AGT2	alanine:glyoxylate aminotransf...		Lus10029922 [exp]	12.8	0.8176
AT4G26470			Calcium-binding EF-hand family...		Lus10027114 [exp]	14.4	0.8068
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10023851 [exp]	16.9	0.8289
AT1G10650			SBP (S-ribonuclease binding pr...		Lus10030597 [exp]	18.4	0.8359

Compare expression of checked genes

Lus10022481 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.