Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23770 89 / 2e-21 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) AT2G33580 86 / 1e-20 Protein kinase superfamily protein (.1) AT1G51940 79 / 3e-18 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) AT1G33260 74 / 2e-16 Protein kinase superfamily protein (.1.2) AT4G35600 72 / 1e-15 Kin4, CX32, CST, CONNEXIN 32, CONNEXIN32 kinase 4, CONNEXIN 32, CAST AWAY, Protein kinase superfamily protein (.1.2) AT3G57120 72 / 2e-15 Protein kinase superfamily protein (.1) AT1G72540 72 / 2e-15 Protein kinase superfamily protein (.1) AT4G23290 71 / 3e-15 CRK21 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2) AT4G11460 71 / 4e-15 CRK30 cysteine-rich RLK (RECEPTOR-like protein kinase) 30 (.1) AT4G23260 70 / 6e-15 CRK18 cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019661 [exp] 172 / 3e-51 AT2G23770 483 / 8e-164 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10000577 [exp] 169 / 2e-50 AT2G23770 490 / 1e-166 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10008586 [exp] 97 / 3e-24 AT2G33580 594 / 0.0 Protein kinase superfamily protein (.1) Lus10042225 [exp] 95 / 6e-24 AT2G33580 209 / 5e-62 Protein kinase superfamily protein (.1) Lus10022488 [exp] 86 / 2e-20 AT2G23770 391 / 2e-128 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10006841 [exp] 81 / 1e-18 AT1G51940 812 / 0.0 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10016794 [exp] 79 / 2e-18 AT2G23770 219 / 2e-66 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10037586 [exp] 77 / 2e-17 AT1G51940 807 / 0.0 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10041171 [exp] 74 / 3e-16 AT2G33580 224 / 1e-64 Protein kinase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G128200 [exp] 160 / 6e-47 AT2G23770 514 / 4e-176 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.007G032100 [exp] 159 / 1e-46 AT2G23770 513 / 6e-175 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.005G259600 [exp] 91 / 2e-22 AT2G33580 637 / 0.0 Protein kinase superfamily protein (.1) Potri.014G040000 [exp] 82 / 5e-19 AT2G23770 345 / 1e-110 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.005G128300 [exp] 79 / 3e-18 AT2G23770 394 / 2e-129 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.015G085400 [exp] 78 / 3e-18 AT2G33580 163 / 4e-46 Protein kinase superfamily protein (.1) Potri.001G190200 [exp] 79 / 4e-18 AT1G51940 824 / 0.0 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.014G156400 [exp] 76 / 4e-17 AT3G21630 678 / 0.0 LYSM DOMAIN RECEPTOR-LIKE KINASE 1, chitin elicitor receptor kinase 1 (.1) Potri.009G010300 [exp] 75 / 2e-16 AT2G23770 234 / 3e-68 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.004G129000 [exp] 73 / 8e-16 AT5G15080 659 / 0.0 Protein kinase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10022489 pacid=23171638 polypeptide=Lus10022489 locus=Lus10022489.g ID=Lus10022489.BGIv1.0 annot-version=v1.0 ATGGCTCCTGAGTATCTGGAGAATGGTCTCGTCTCTACAAAGATTGATGTTTTTGCATTTGGTATTCTTCTTCTCGAGATGACAGCTGGGAAAGAAGTTG CTTCCTTTTATAGAGAGGGGGCTAATGGGTTATCAAATGTATTGGAGGAACTTCTTTCTGATGCAGAAGATGGTGAAGAGGATAATCTCAGGCAATTCCT GGACCCATCAGTGGAAGGGAACTATCGAACAGACCTTGCTGTCTTTGTACTGAGGTTGGTTCATGGCTGCCTAAACAAGAACCCTGCAAATCGGCCAGCT ATGAACGAGCTCGTGCAATCTCTTTCAAGAATCTTAACAGCGTCGCTATCCTGGGAATTGTCTAATAACCTCTCACATTATAGGAATCCATGA
AA sequence Show only first row Show all	>Lus10022489 pacid=23171638 polypeptide=Lus10022489 locus=Lus10022489.g ID=Lus10022489.BGIv1.0 annot-version=v1.0 MAPEYLENGLVSTKIDVFAFGILLLEMTAGKEVASFYREGANGLSNVLEELLSDAEDGEEDNLRQFLDPSVEGNYRTDLAVFVLRLVHGCLNKNPANRPA MNELVQSLSRILTASLSWELSNNLSHYRNP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G33580			Protein kinase superfamily pro...		Lus10022489 [exp]	0	1
					Lus10007681 [exp]	3.5	0.7358
AT5G13790	MADS	AGL15	AGAMOUS-like 15 (.1)		Lus10039580 [exp]	4.4	0.7784
AT4G24630			DHHC-type zinc finger family p...		Lus10033527 [exp]	11.2	0.7117
AT1G49390			2-oxoglutarate (2OG) and Fe(II...		Lus10008826 [exp]	12.7	0.6789
AT1G66140	C2H2ZnF	ZFP4	zinc finger protein 4 (.1)		Lus10013243 [exp]	13.0	0.6916
AT3G24330			O-Glycosyl hydrolases family 1...		Lus10033082 [exp]	15.0	0.7084
AT4G22990			Major Facilitator Superfamily ...		Lus10009314 [exp]	21.6	0.6977
AT3G51150			ATP binding microtubule motor ...		Lus10010624 [exp]	24.0	0.6697
AT5G47740			Adenine nucleotide alpha hydro...		Lus10043338 [exp]	26.5	0.6813
AT1G29660			GDSL-like Lipase/Acylhydrolase...		Lus10032316 [exp]	26.6	0.7012

Compare expression of checked genes

Lus10022489 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.