Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G33580 98 / 3e-25 Protein kinase superfamily protein (.1) AT2G23770 87 / 2e-21 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) AT4G28490 83 / 5e-20 RLK5, HAESA RECEPTOR-LIKE PROTEIN KINASE 5, HAESA, Leucine-rich receptor-like protein kinase family protein (.1) AT3G46330 81 / 2e-19 MEE39 maternal effect embryo arrest 39, Leucine-rich repeat protein kinase family protein (.1) AT2G28970 79 / 1e-18 Leucine-rich repeat protein kinase family protein (.1) AT3G46400 78 / 3e-18 Leucine-rich repeat protein kinase family protein (.1) AT2G14440 78 / 4e-18 Leucine-rich repeat protein kinase family protein (.1) AT2G28990 77 / 5e-18 Leucine-rich repeat protein kinase family protein (.1) AT1G49100 77 / 6e-18 Leucine-rich repeat protein kinase family protein (.1) AT3G21630 77 / 8e-18 LYSMRLK1, CERK1 LYSM DOMAIN RECEPTOR-LIKE KINASE 1, chitin elicitor receptor kinase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019661 [exp] 129 / 3e-36 AT2G23770 483 / 8e-164 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10000577 [exp] 124 / 2e-34 AT2G23770 490 / 1e-166 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10016794 [exp] 96 / 5e-25 AT2G23770 219 / 2e-66 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10022488 [exp] 97 / 6e-25 AT2G23770 391 / 2e-128 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10008586 [exp] 92 / 3e-23 AT2G33580 594 / 0.0 Protein kinase superfamily protein (.1) Lus10019662 [exp] 86 / 4e-21 AT2G33580 198 / 3e-57 Protein kinase superfamily protein (.1) Lus10016299 [exp] 86 / 6e-21 AT2G23770 368 / 3e-119 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10041171 [exp] 85 / 1e-20 AT2G33580 224 / 1e-64 Protein kinase superfamily protein (.1) Lus10039406 [exp] 84 / 2e-20 AT2G33580 229 / 4e-68 Protein kinase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G032100 [exp] 122 / 7e-34 AT2G23770 513 / 6e-175 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.005G128200 [exp] 112 / 3e-30 AT2G23770 514 / 4e-176 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.014G040000 [exp] 89 / 4e-22 AT2G23770 345 / 1e-110 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.007G032300 [exp] 88 / 1e-21 AT2G33580 247 / 6e-73 Protein kinase superfamily protein (.1) Potri.005G128401 [exp] 85 / 2e-21 AT2G33580 196 / 1e-57 Protein kinase superfamily protein (.1) Potri.005G259600 [exp] 85 / 1e-20 AT2G33580 637 / 0.0 Protein kinase superfamily protein (.1) Potri.009G100400 [exp] 84 / 4e-20 AT3G19300 773 / 0.0 Protein kinase superfamily protein (.1) Potri.006G252600 [exp] 81 / 4e-19 AT1G51940 326 / 4e-103 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.005G128300 [exp] 80 / 7e-19 AT2G23770 394 / 2e-129 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.011G010000 [exp] 79 / 1e-18 AT3G21630 673 / 0.0 LYSM DOMAIN RECEPTOR-LIKE KINASE 1, chitin elicitor receptor kinase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF07714 [flax] [poplar] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Lus10022490 pacid=23171754 polypeptide=Lus10022490 locus=Lus10022490.g ID=Lus10022490.BGIv1.0 annot-version=v1.0 ATGGATGAGGATGTATCCAAGGAGATAAATTTACTAAATAAGTTTGCTGCTAATGGGGCATTAAGCGACTGGATTTATTCATCAACCAATGGCGGCAAGG AATTGACTTGGCCTCAAAGAGTACAGATTGCTCTGGATGTAGCTTTGGGACTTGACTATTTACACAGTTTCACTAGTCCTCCACAAGTCCACAAGGACAT AAAAAGTAGGAACGTGCTTCTTGACAAAGATTTCAGGGTCAAGATAGCCAACTTAGCACAGGCGAGATCAGCTGAGGTGAATTCAATCTGA
AA sequence Show only first row Show all	>Lus10022490 pacid=23171754 polypeptide=Lus10022490 locus=Lus10022490.g ID=Lus10022490.BGIv1.0 annot-version=v1.0 MDEDVSKEINLLNKFAANGALSDWIYSSTNGGKELTWPQRVQIALDVALGLDYLHSFTSPPQVHKDIKSRNVLLDKDFRVKIANLAQARSAEVNSI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G33580			Protein kinase superfamily pro...		Lus10022490 [exp]	0	1
AT3G54570			Plant calmodulin-binding prote...		Lus10039544 [exp]	3.3	0.7373
AT2G31960		ATGSL3, ATGSL03	glucan synthase-like 3 (.1.2)		Lus10003917 [exp]	8.1	0.7338
AT1G73850			Protein of unknown function (D...		Lus10027226 [exp]	13.3	0.7326
AT5G08350			GRAM domain-containing protein...		Lus10013445 [exp]	14.6	0.7026
					Lus10008258 [exp]	20.2	0.5927
AT1G69700		ATHVA22C	HVA22 homologue C (.1)		Lus10037191 [exp]	21.2	0.6760
AT1G06490		CalS7, ATGSL7, ...	callose synthase 7, Arabidopsi...		Lus10007327 [exp]	21.3	0.6694
AT1G73850			Protein of unknown function (D...		Lus10038936 [exp]	22.4	0.6982
AT3G11680			Aluminium activated malate tra...		Lus10021272 [exp]	24.4	0.6943
AT2G37050			Leucine-rich repeat protein ki...		Lus10019907 [exp]	24.7	0.6820

Compare expression of checked genes

Lus10022490 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.