Plant FIBer expression Database

Lus10022501 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39740 76 / 2e-17 HCC2 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016805
[exp]
185 / 1e-59 AT4G39740 328 / 9e-114 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G091300
[exp]
84 / 2e-20 AT4G39740 310 / 1e-106 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
Potri.005G076700
[exp]
79 / 8e-19 AT4G39740 328 / 1e-113 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10022501 pacid=23171709 polypeptide=Lus10022501 locus=Lus10022501.g ID=Lus10022501.BGIv1.0 annot-version=v1.0
ATGATGCCCCTTTCTCAGGTTTTTTCCTTCGCATCCAAACACCCGCTAAGGCAGAATCAGGCTCTCACTCAACTTCGAAGGTTTGTTGCATCAAGGAAGA
ATCAGTCTCGTAGCTATTCCAAATCTAACAAGCAAGGTCATGAAAAGCGGAATACTCATCATATATATCCCGTTGAACAGCAGCCTCATCAATCTTATGC
TTCGTTCATCCTTCCTGGTGCTGTCCTAGGATTTGCTGGACTGGCAGCTTATATTCATTATAATGACGAGAAGAGAGCAATTCCGAAGGAAGGCAAGTTC
CATGCCTTGATTCAAGACACGACATCCGATCTTCCTGTCTATGAGAATTCTGGAATCATGATGGATAGTAACTGTGTAGTTATGATCTAG
AA sequence
>Lus10022501 pacid=23171709 polypeptide=Lus10022501 locus=Lus10022501.g ID=Lus10022501.BGIv1.0 annot-version=v1.0
MMPLSQVFSFASKHPLRQNQALTQLRRFVASRKNQSRSYSKSNKQGHEKRNTHHIYPVEQQPHQSYASFILPGAVLGFAGLAAYIHYNDEKRAIPKEGKF
HALIQDTTSDLPVYENSGIMMDSNCVVMI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G39740 HCC2 homologue of copper chaperone ... Lus10022501
[exp]
0 1
AT5G17680 disease resistance protein (TI... Lus10012852
[exp]
34.2 0.6394
AT1G64690 BLT BRANCHLESS TRICHOMES, branchle... Lus10005316
[exp]
44.0 0.6102
AT1G79160 unknown protein Lus10031179
[exp]
46.7 0.6728
AT5G25610 ATRD22, RD22 RESPONSIVE TO DESSICATION 22, ... Lus10024706
[exp]
59.7 0.6396
AT3G03450 GRAS RGL2 RGA-like 2 (.1) Lus10036459
[exp]
72.3 0.6165
AT1G11300 protein serine/threonine kinas... Lus10007600
[exp]
82.0 0.6531
Lus10028949
[exp]
95.8 0.6057
AT4G21390 B120 S-locus lectin protein kinase ... Lus10018408
[exp]
105.7 0.6386
AT5G52390 PAR1 protein (.1) Lus10040714
[exp]
107.5 0.6046
AT5G09360 LAC14 laccase 14 (.1) Lus10026812
[exp]
137.6 0.6128

Lus10022501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.