Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39700 191 / 3e-63 Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 174 / 1e-56 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 163 / 3e-52 Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 161 / 2e-51 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT4G38580 149 / 8e-47 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT5G17450 144 / 8e-45 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT5G66110 144 / 1e-44 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 131 / 7e-40 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 97 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 96 / 9e-26 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016812 [exp] 282 / 2e-99 AT4G39700 181 / 3e-59 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 245 / 1e-84 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 244 / 4e-84 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10039419 [exp] 172 / 8e-56 AT4G08570 215 / 5e-73 Heavy metal transport/detoxification superfamily protein (.1) Lus10016708 [exp] 169 / 2e-54 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10036004 [exp] 168 / 3e-54 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 165 / 5e-53 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10032446 [exp] 158 / 7e-50 AT1G71050 175 / 2e-56 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10009115 [exp] 157 / 7e-50 AT5G17450 206 / 5e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G079800 [exp] 227 / 1e-77 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 217 / 1e-73 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 174 / 2e-56 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 173 / 2e-56 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 172 / 4e-56 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.005G003700 [exp] 165 / 5e-53 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1) Potri.017G123400 [exp] 161 / 9e-52 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G175400 [exp] 156 / 1e-49 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.009G135300 [exp] 151 / 2e-47 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G110400 [exp] 141 / 1e-43 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10022508 pacid=23171713 polypeptide=Lus10022508 locus=Lus10022508.g ID=Lus10022508.BGIv1.0 annot-version=v1.0 ATGGGAATTGGAGGAAGTTTGGAGTATTTGTGTGAGTTAATGATGGCGAACTCTGACAAAAAGAAGAAGAAGAGGAAGCAAATGCAGAGTGTGGAGCTGA AGGTGAGGATGGATTGTGATGGATGCGAGCTTAAGGTCAAGAAAGCACTTTCTTCATTAACTGGGGTGAAAAGTGTGGAGATAAACAGGAAGCAGCAGAA GGTGACAGTAACAGGGTATGTGGAACCACACAAGGTACTGAACAAGGCGAAATCAACTGGAAAAAGATGTGAGATTTGGCCATACATTCCATACAACACA GTGGCTCAACCGTATATTGCTGGAACTTACGACAAGAAAGCACCTCCTGGTTATGTAAGAAATGTTGAGCAAAGTAGTGGAACAGCAATCACAAGATATG AAGAAGACCCTTACACCTCCATGTTCAGTGATGACAACCCAAATGCATGTTCCATTATGTAA
AA sequence Show only first row Show all	>Lus10022508 pacid=23171713 polypeptide=Lus10022508 locus=Lus10022508.g ID=Lus10022508.BGIv1.0 annot-version=v1.0 MGIGGSLEYLCELMMANSDKKKKKRKQMQSVELKVRMDCDGCELKVKKALSSLTGVKSVEINRKQQKVTVTGYVEPHKVLNKAKSTGKRCEIWPYIPYNT VAQPYIAGTYDKKAPPGYVRNVEQSSGTAITRYEEDPYTSMFSDDNPNACSIM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39700			Heavy metal transport/detoxifi...		Lus10022508 [exp]	0	1
AT3G06270			Protein phosphatase 2C family ...		Lus10041242 [exp]	1.4	0.9047
AT1G07410		ATRAB-A2B, AtRA...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10040255 [exp]	1.4	0.8620
AT4G02590	bHLH	bHLH059, UNE12	unfertilized embryo sac 12, ba...		Lus10014726 [exp]	2.4	0.8441
AT3G25620		ABCG21	ATP-binding cassette G21, ABC-...		Lus10034387 [exp]	2.8	0.8487
AT3G27030			unknown protein		Lus10041551 [exp]	3.2	0.8372
AT5G15100		ATPIN8, PIN8	PIN-FORMED 8, Auxin efflux car...		Lus10013422 [exp]	3.7	0.8435
AT2G44380			Cysteine/Histidine-rich C1 dom...		Lus10037470 [exp]	4.0	0.8410
AT2G34790		MEE23, EDA28	MATERNAL EFFECT EMBRYO ARREST ...		Lus10023363 [exp]	6.7	0.8372
AT1G03440			Leucine-rich repeat (LRR) fami...		Lus10029622 [exp]	6.7	0.8236
AT1G65820			microsomal glutathione s-trans...		Lus10020792 [exp]	7.3	0.8574

Compare expression of checked genes

Lus10022508 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.