Lus10022528 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022527 49 / 2e-07 AT5G04220 84 / 2e-18 synaptotagmin 3, Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2)
Lus10022529 47 / 3e-07 ND /
Lus10005510 44 / 8e-06 AT4G19880 162 / 3e-48 Glutathione S-transferase family protein (.1.2.3)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10022528 pacid=23166926 polypeptide=Lus10022528 locus=Lus10022528.g ID=Lus10022528.BGIv1.0 annot-version=v1.0
ATGAGTCTTCGAACTCTTCCTCCCACTATTCATGATCATGTTGGGTTAATTGATGCCAAGGGTGAAGATGATAGCAGTGACATTGTTGATGCGTTGCTCC
GTTACGCTGCCTGCAACAGTGTGATCGTTTGTTTTTTGTCCATGGAGTTTTTGCTAAAAACCAGGTGGATTTCGGGTGGGGAGGACTTGTTGGTACAACT
TCAGATTGGTTCGGTGAATGGAAAATGGGGTGACCACTCGAGTCCTTATTGTGGGAAGAGTTTTCAGCAGTTGTTCTCCACCGATTTGGCACTACAACTC
TGTCTTGTGCACCTCCGTCACCAAGACAGCTTGCAGCTTCATGGTCATACAATCCTTCTATATTTGCTCGCGAGGACTACACAAATGGGACACCAGAGTA
CATCACGATTTACAGGTTTTACACTCCAATTGTCACCTTGA
AA sequence
>Lus10022528 pacid=23166926 polypeptide=Lus10022528 locus=Lus10022528.g ID=Lus10022528.BGIv1.0 annot-version=v1.0
MSLRTLPPTIHDHVGLIDAKGEDDSSDIVDALLRYAACNSVIVCFLSMEFLLKTRWISGGEDLLVQLQIGSVNGKWGDHSSPYCGKSFQQLFSTDLALQL
CLVHLRHQDSLQLHGHTILLYLLARTTQMGHQSTSRFTGFTLQLSP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10022528 0 1
AT2G38540 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRA... Lus10022744 1.0 1.0000
AT5G03250 Phototropic-responsive NPH3 fa... Lus10009292 2.2 0.7423
AT2G42000 AtMT4a Arabidopsis thaliana metalloth... Lus10022998 2.4 0.8497
AT3G28470 MYB TDF1, ATMYB35 DEFECTIVE IN MERISTEM DEVELOPM... Lus10036660 4.9 0.7383
AT4G14746 unknown protein Lus10035902 9.8 0.9143
AT1G79860 ATROPGEF12, ROP... MATERNAL EFFECT EMBRYO ARREST ... Lus10037866 18.9 0.7653
AT5G05280 RING/U-box superfamily protein... Lus10036380 26.3 0.7315
AT4G35580 NAC NTL9, CBNAC NAC transcription factor-like ... Lus10005144 28.1 0.7315
AT5G06720 ATPA2 peroxidase 2 (.1) Lus10027988 29.8 0.7315
AT5G59190 subtilase family protein (.1) Lus10040254 31.5 0.7315

Lus10022528 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.