Lus10022533 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G55840 365 / 9e-129 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
AT5G47730 329 / 9e-115 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
AT4G39180 67 / 9e-13 ATSEC14, SEC14 ARABIDOPSIS THALIANA SECRETION 14, Sec14p-like phosphatidylinositol transfer family protein (.1.2)
AT4G34580 65 / 6e-12 SRH1, COW1 SHORT ROOT HAIR 1, CAN OF WORMS1, Sec14p-like phosphatidylinositol transfer family protein (.1)
AT2G21520 64 / 1e-11 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
AT2G18180 63 / 2e-11 Sec14p-like phosphatidylinositol transfer family protein (.1)
AT2G21540 61 / 9e-11 ATSFH3 SEC14-like 3 (.1.2.3)
AT4G36490 60 / 2e-10 ATSFH12 SEC14-like 12 (.1)
AT2G16380 59 / 3e-10 Sec14p-like phosphatidylinositol transfer family protein (.1)
AT1G75370 58 / 1e-09 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016628 463 / 1e-166 AT1G55840 415 / 5e-146 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
Lus10032587 385 / 2e-136 AT1G55840 407 / 2e-143 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
Lus10043160 368 / 4e-126 AT1G55840 427 / 1e-147 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
Lus10038752 351 / 2e-122 AT5G47730 489 / 4e-175 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Lus10039106 340 / 4e-118 AT5G47730 459 / 2e-163 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Lus10022790 63 / 2e-11 AT3G24840 650 / 0.0 Sec14p-like phosphatidylinositol transfer family protein (.1)
Lus10025988 60 / 4e-10 AT2G18180 662 / 0.0 Sec14p-like phosphatidylinositol transfer family protein (.1)
Lus10026356 59 / 8e-10 AT2G21520 925 / 0.0 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
Lus10042302 59 / 8e-10 AT2G21520 910 / 0.0 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G369400 373 / 4e-131 AT1G55840 466 / 4e-166 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
Potri.006G004000 363 / 2e-127 AT5G47730 497 / 3e-178 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Potri.016G005100 354 / 1e-123 AT5G47730 501 / 7e-180 Sec14p-like phosphatidylinositol transfer family protein (.1.2.3)
Potri.005G119700 62 / 4e-11 AT4G36490 726 / 0.0 SEC14-like 12 (.1)
Potri.004G157700 61 / 1e-10 AT2G21520 908 / 0.0 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
Potri.009G119500 61 / 1e-10 AT2G21520 975 / 0.0 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
Potri.007G020300 61 / 1e-10 AT4G36490 731 / 0.0 SEC14-like 12 (.1)
Potri.002G032600 58 / 1e-09 AT2G21520 731 / 0.0 Sec14p-like phosphatidylinositol transfer family protein (.1.2)
Potri.003G076200 58 / 1e-09 AT5G47510 397 / 1e-136 Sec14p-like phosphatidylinositol transfer family protein (.1)
Potri.003G162100 57 / 2e-09 AT1G01630 356 / 2e-125 Sec14p-like phosphatidylinositol transfer family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0512 CRAL_TRIO PF00650 CRAL_TRIO CRAL/TRIO domain
Representative CDS sequence
>Lus10022533 pacid=23166905 polypeptide=Lus10022533 locus=Lus10022533.g ID=Lus10022533.BGIv1.0 annot-version=v1.0
ATGAAACCAATCGTTCCAACTGAATTGTATACATCAATTCGGGATACTCAGCTTGTCGGATTGTCAGGTTACTCTAAAGAGGGTCTTCCTGTTGTTGCTT
GCGGTGTGGGGCAAAGCACGTATGACAAAGCTTCTGTTCATTACTATGTCCAGTCACACATCCAAATGAATGAATACCGGGACCGTGTAGTATTGCCTAA
TGCGACGAAGAAATATGGAAGGCACATAGGCACATGTATTAAGATCTTGGATATGACTGGCCTAAAATTTTCAGCATTAAATCAAATTAAGTTGTTAACT
GCAATTTCTACAACCGACGACTTAAATTATCCAGAGAAGACGGAGACATATTACATTGTCAATGTCCCATACATTTTTTCAGCCTGTTGGAAGGTTGTAA
AGCCTTTATTGCAGGAGAGGACAAGGAAGAAAATCCAGATAATGGATTATTCATCGCTGCCTCATTTCTGTAGAAAAGAAGGCTCTGGATCATCTCGTGT
TGCAGCAAGTGGAACCACCGTAAACTGCTTCTCGTTAGATCATCCTTTGCATCAGCAGTTATACGACTTCGCTAAACAACAAGCTGCCTTGGAGGAATCT
GCTTCACCTCTGAAGCAAGGTTCCGTCCATGTAGATTTCCCAGAGCCTGACGCTAACGATACTAAGATCATGAAGACGATAGAGTCCGAGATCCACTAG
AA sequence
>Lus10022533 pacid=23166905 polypeptide=Lus10022533 locus=Lus10022533.g ID=Lus10022533.BGIv1.0 annot-version=v1.0
MKPIVPTELYTSIRDTQLVGLSGYSKEGLPVVACGVGQSTYDKASVHYYVQSHIQMNEYRDRVVLPNATKKYGRHIGTCIKILDMTGLKFSALNQIKLLT
AISTTDDLNYPEKTETYYIVNVPYIFSACWKVVKPLLQERTRKKIQIMDYSSLPHFCRKEGSGSSRVAASGTTVNCFSLDHPLHQQLYDFAKQQAALEES
ASPLKQGSVHVDFPEPDANDTKIMKTIESEIH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G55840 Sec14p-like phosphatidylinosit... Lus10022533 0 1
AT3G44900 ATCHX4 cation/H+ exchanger 4, cation/... Lus10032622 2.4 0.9197
AT3G48670 RDM12, IDN2 RNA-DIRECTED DNA METHYLATION 1... Lus10002305 3.5 0.9102
AT3G17220 ATPMEI2 pectin methylesterase inhibito... Lus10017347 3.7 0.9132
AT1G60783 unknown protein Lus10004622 4.5 0.9090
AT1G69580 GARP Homeodomain-like superfamily p... Lus10036758 6.5 0.9053
AT1G07400 HSP20-like chaperones superfam... Lus10022604 10.2 0.9028
AT3G44735 PSK1, ATPSK3 PHYTOSULFOKINE 3 PRECURSOR (.1... Lus10035572 12.0 0.8984
AT5G22580 Stress responsive A/B Barrel D... Lus10020555 12.4 0.9052
AT4G19510 Disease resistance protein (TI... Lus10008209 13.1 0.9017
AT1G63300 Myosin heavy chain-related pro... Lus10027462 14.7 0.8245

Lus10022533 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.