Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G26840 44 / 2e-07 ATSUMO1, SUMO1, SUM1 ARABIDOPSIS THALIANA SMALL UBIQUITIN-LIKE MODIFIER 1, small ubiquitin-like modifier 1 (.1) AT5G55160 44 / 2e-07 ATSUMO2, SUMO2, SUM2 small ubiquitin-like modifier 2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032561 [exp] 44 / 3e-07 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2) Lus10043185 [exp] 44 / 3e-07 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2) Lus10032560 [exp] 44 / 3e-07 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G224700 [exp] 40 / 5e-06 AT4G26840 170 / 1e-56 ARABIDOPSIS THALIANA SMALL UBIQUITIN-LIKE MODIFIER 1, small ubiquitin-like modifier 1 (.1) Potri.014G158300 [exp] 40 / 6e-06 AT5G55160 171 / 5e-57 small ubiquitin-like modifier 2 (.1.2) Potri.002G224800 [exp] 40 / 6e-06 AT5G55160 172 / 3e-57 small ubiquitin-like modifier 2 (.1.2) Potri.014G190300 [exp] 39 / 2e-05 AT5G55160 168 / 7e-56 small ubiquitin-like modifier 2 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF11976 [flax] [poplar] Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Representative CDS sequence Show only first row Show all	>Lus10022539 pacid=23166916 polypeptide=Lus10022539 locus=Lus10022539.g ID=Lus10022539.BGIv1.0 annot-version=v1.0 ATGGTTTGCCTTAGAGTGAGTCGAACCATCGAGCTGAAGAAGTTAATGGAAATGTATTGCGAGAACCAACAAAGAGACATGAACACTGCCCGTTTCGATT ACGATGGCAAAAGAGTGCATTCGACCGATGCCCATCTCAAGCTTGAGTTGGAGGATGAAGATGAGATTGATATCTTTGAGGACCAGATTGGAGGAGGAGG CAATTAG
AA sequence Show only first row Show all	>Lus10022539 pacid=23166916 polypeptide=Lus10022539 locus=Lus10022539.g ID=Lus10022539.BGIv1.0 annot-version=v1.0 MVCLRVSRTIELKKLMEMYCENQQRDMNTARFDYDGKRVHSTDAHLKLELEDEDEIDIFEDQIGGGGN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10022539 [exp]	0	1
AT1G67590			Remorin family protein (.1.2)		Lus10015817 [exp]	2.4	0.8663
AT1G80530			Major facilitator superfamily ...		Lus10030111 [exp]	4.7	0.7745
AT2G22600			RNA-binding KH domain-containi...		Lus10002662 [exp]	5.5	0.8017
AT1G67590			Remorin family protein (.1.2)		Lus10036996 [exp]	5.7	0.8189
AT3G10050		OMR1	L-O-methylthreonine resistant ...		Lus10014390 [exp]	5.8	0.8455
AT1G47720		OSB1	Organellar Single-stranded, Pr...		Lus10014728 [exp]	14.2	0.7800
AT1G04590		EMB2748	unknown protein		Lus10015943 [exp]	14.9	0.7690
AT3G13275			unknown protein		Lus10007090 [exp]	20.2	0.7817
AT1G60660		B5 #5, B5#5, AT...	ARABIDOPSIS CYTOCHROME B5-LIKE...		Lus10034972 [exp]	21.4	0.7341
AT5G41050			Pollen Ole e 1 allergen and ex...		Lus10041541 [exp]	21.9	0.7705

Compare expression of checked genes

Lus10022539 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.