Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13950 92 / 3e-25 RALFL31 ralf-like 31 (.1) AT3G23805 86 / 5e-23 RALFL24 ralf-like 24 (.1) AT3G05490 69 / 3e-16 RALFL22 ralf-like 22 (.1) AT3G16570 68 / 1e-15 ATRALF23, RALFL23 ARABIDOPSIS RAPID ALKALINIZATION FACTOR 23, rapid alkalinization factor 23 (.1) AT4G15800 65 / 1e-14 RALFL33 ralf-like 33 (.1) AT2G33775 63 / 6e-14 RALFL19 ralf-like 19 (.1) AT1G02900 61 / 3e-13 RALF1, RALFL1, ATRALF1 RALF-LIKE 1, rapid alkalinization factor 1 (.1) AT1G28270 60 / 6e-13 RALFL4 ralf-like 4 (.1) AT5G67070 45 / 7e-07 RALFL34 ralf-like 34 (.1) AT1G35467 40 / 2e-05 RALFL5 RALF-like 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016646 [exp] 166 / 8e-55 AT4G13950 100 / 1e-28 ralf-like 31 (.1) Lus10020647 [exp] 71 / 5e-17 AT4G15800 119 / 5e-36 ralf-like 33 (.1) Lus10029893 [exp] 71 / 6e-17 AT4G15800 116 / 8e-35 ralf-like 33 (.1) Lus10015172 [exp] 68 / 1e-15 AT4G15800 107 / 2e-31 ralf-like 33 (.1) Lus10000502 [exp] 64 / 3e-14 AT4G15800 134 / 1e-41 ralf-like 33 (.1) Lus10037512 [exp] 63 / 8e-14 AT4G15800 131 / 9e-41 ralf-like 33 (.1) Lus10025444 [exp] 57 / 9e-12 AT1G28270 100 / 2e-28 ralf-like 4 (.1) Lus10015316 [exp] 57 / 1e-11 AT1G28270 100 / 7e-29 ralf-like 4 (.1) Lus10015431 [exp] 52 / 2e-09 AT1G28270 81 / 7e-21 ralf-like 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G320700 [exp] 92 / 6e-25 AT3G23805 96 / 1e-26 ralf-like 24 (.1) Potri.017G059500 [exp] 84 / 7e-22 AT4G13950 96 / 2e-26 ralf-like 31 (.1) Potri.004G044900 [exp] 64 / 2e-14 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.004G045000 [exp] 64 / 2e-14 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.005G025800 [exp] 62 / 1e-13 AT4G15800 138 / 1e-43 ralf-like 33 (.1) Potri.008G208200 [exp] 60 / 7e-13 AT4G15800 132 / 2e-41 ralf-like 33 (.1) Potri.013G017400 [exp] 59 / 2e-12 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.014G131800 [exp] 57 / 1e-11 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.007G044700 [exp] 48 / 5e-08 AT5G67070 119 / 1e-35 ralf-like 34 (.1) Potri.005G139100 [exp] 44 / 1e-06 AT5G67070 118 / 4e-35 ralf-like 34 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [flax] [poplar] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Lus10022561 pacid=23166937 polypeptide=Lus10022561 locus=Lus10022561.g ID=Lus10022561.BGIv1.0 annot-version=v1.0 ATGCTGCTAAAGCCCTTCACTTCCCTCCAAATTCTCTTATTGTCTCTCATTCTCTTCAACCCCAATTCCACAATTTCTAATGGGTTCTCCTCAGTTGAAG CTGGCGCATTTTACCCGGGCGAAGAAGAGCCAGTGGAGATGGAGTCGGAGATCAGTAGGAGGATGCTGATGATGCAGAGGAGATACATAAGCTACGCGAC TCTGAAGAGGGATATGGTCCCTTGCGACAATGCAGGTGCTTCCTATTACGATTGCCATCGTTCTCGACCGGCTAACACTTATACCCGAGGTTGTGAGGTC ATCACCAGGTGCGCTAGAGATATCAAAGACTTAAACGATTGA
AA sequence Show only first row Show all	>Lus10022561 pacid=23166937 polypeptide=Lus10022561 locus=Lus10022561.g ID=Lus10022561.BGIv1.0 annot-version=v1.0 MLLKPFTSLQILLLSLILFNPNSTISNGFSSVEAGAFYPGEEEPVEMESEISRRMLMMQRRYISYATLKRDMVPCDNAGASYYDCHRSRPANTYTRGCEV ITRCARDIKDLND

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G13950		RALFL31	ralf-like 31 (.1)		Lus10022561 [exp]	0	1
AT1G26355		SP1L1	SPIRAL1-like1 (.1)		Lus10004642 [exp]	2.6	0.8645
AT5G59510		RTFL5, DVL18	DEVIL 18, ROTUNDIFOLIA like 5 ...		Lus10040784 [exp]	3.9	0.8748
AT2G17800		ARAC1, ATGP2, A...	RHO-RELATED GTPASES FROM PLANT...		Lus10041881 [exp]	4.2	0.8797
AT4G23740			Leucine-rich repeat protein ki...		Lus10032351 [exp]	6.3	0.8795
AT3G60580	C2H2ZnF		C2H2-like zinc finger protein ...		Lus10028951 [exp]	7.3	0.8939
AT3G14920			Peptide-N4-(N-acetyl-beta-gluc...		Lus10017926 [exp]	8.2	0.8818
AT3G60580	C2H2ZnF		C2H2-like zinc finger protein ...		Lus10007474 [exp]	14.7	0.8714
AT4G23740			Leucine-rich repeat protein ki...		Lus10033936 [exp]	18.5	0.8606
AT3G28420			Putative membrane lipoprotein ...		Lus10039459 [exp]	25.2	0.8196
AT3G24660		TMKL1	transmembrane kinase-like 1 (....		Lus10011886 [exp]	25.4	0.8345

Compare expression of checked genes

Lus10022561 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.