Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022379 [exp] 204 / 1e-66 AT5G27260 74 / 1e-14 unknown protein Lus10004397 [exp] 201 / 1e-65 AT5G27260 77 / 6e-16 unknown protein Lus10006034 [exp] 127 / 2e-37 AT5G27260 42 / 2e-04 unknown protein Lus10034368 [exp] 125 / 2e-36 AT5G38900 147 / 2e-43 Thioredoxin superfamily protein (.1) Lus10018174 [exp] 125 / 7e-36 AT5G41980 68 / 1e-12 unknown protein Lus10010798 [exp] 125 / 6e-35 AT5G27260 61 / 5e-10 unknown protein Lus10024284 [exp] 101 / 3e-28 AT5G27260 50 / 2e-07 unknown protein Lus10026427 [exp] 93 / 8e-25 ND / Lus10004902 [exp] 81 / 1e-20 ND 36 / 0.002
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022573 pacid=23166917 polypeptide=Lus10022573 locus=Lus10022573.g ID=Lus10022573.BGIv1.0 annot-version=v1.0 ATGAGGAGGAGAGAAAATGTAGAAGGTGGTAGTCAGAGTACTCGAGATTACAGACTGTGGACCAAACTTGAGGAGAAGACACTGGTAGAGTGTATGATGG GGCTGACTGAGACGGGACTCGTCGAGAACGGAAACTTTCGAACAAGTGGACTGAAGAAGCTAGAAAAGATGATGTATGCAAAGTTGGTTGACCATCAACT GAGAGCTGTTCCCCACATAAAGTCCAAGATTCCGTATTTTAAGGAAAAGTTCATGGCCTTTCTCCAACTCAAACTAACAAGTGGTGTTGGTTGGGATGGA ATTTATGGCTGCATCGTGGCTGATGATGATATGTTTAATGAATGA
AA sequence Show only first row Show all	>Lus10022573 pacid=23166917 polypeptide=Lus10022573 locus=Lus10022573.g ID=Lus10022573.BGIv1.0 annot-version=v1.0 MRRRENVEGGSQSTRDYRLWTKLEEKTLVECMMGLTETGLVENGNFRTSGLKKLEKMMYAKLVDHQLRAVPHIKSKIPYFKEKFMAFLQLKLTSGVGWDG IYGCIVADDDMFNE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022573 [exp]	0	1
AT2G18370			Bifunctional inhibitor/lipid-t...		Lus10001431 [exp]	1.7	1.0000
					Lus10003840 [exp]	2.4	1.0000
					Lus10005396 [exp]	3.0	1.0000
					Lus10006661 [exp]	4.0	1.0000
AT5G67210		IRX15-L	IRX15-LIKE, Protein of unknown...		Lus10009378 [exp]	4.5	1.0000
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10038264 [exp]	4.9	1.0000
AT5G14400		CYP724A1	"cytochrome P450, family 724, ...		Lus10003650 [exp]	5.7	1.0000
					Lus10012429 [exp]	5.9	1.0000
AT3G48460			GDSL-like Lipase/Acylhydrolase...		Lus10002389 [exp]	6.0	0.9777
					Lus10011723 [exp]	6.7	0.9841

Compare expression of checked genes

Lus10022573 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.