Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G28410 77 / 3e-19 unknown protein AT5G60650 37 / 0.0008 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021476 [exp] 159 / 9e-52 AT2G28410 94 / 7e-26 unknown protein Lus10041307 [exp] 43 / 2e-05 AT5G60640 536 / 0.0 ARABIDOPSIS THALIANA PROTEIN DISULFIDE ISOMERASE 2, PDI-like 1-4 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G211000 [exp] 93 / 3e-25 AT2G28410 62 / 5e-13 unknown protein Potri.009G013800 [exp] 81 / 1e-20 AT2G28410 52 / 3e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022579 pacid=23178654 polypeptide=Lus10022579 locus=Lus10022579.g ID=Lus10022579.BGIv1.0 annot-version=v1.0 ATGGCTCTTTCTCCAATCTTCTTCTTCTTCTTCTTCATCTTGATGATCTTCTCCTCTCCAGCTTCAGTTTCCATTGCCATGGCTCAAGGCAGAGCACCCC ACGGCCTAGTCTACGAGAGCCCTGTCGCCTTCTCCCCGTCAGCAGTTGAGTTCTTCCACCCAAAGAGACAAGACCCCATGGTCGTCATGAAGCCATGTCA GGAATCCTCTGGCTGCTCTCCTCTCCCCATGGCTGCTCAGATGGCGGTACAGGATCAGACCAATAAAGTGTCGAGTCCGAGGAGCGAGAATGGTGGGAGT CGGAACGAGTTTGGTGTGGGGAGCACTGTCGGGAGTATGTTTGGTGTGTCGTTTGTTGTGTTCTTGACCATGTTGTGA
AA sequence Show only first row Show all	>Lus10022579 pacid=23178654 polypeptide=Lus10022579 locus=Lus10022579.g ID=Lus10022579.BGIv1.0 annot-version=v1.0 MALSPIFFFFFFILMIFSSPASVSIAMAQGRAPHGLVYESPVAFSPSAVEFFHPKRQDPMVVMKPCQESSGCSPLPMAAQMAVQDQTNKVSSPRSENGGS RNEFGVGSTVGSMFGVSFVVFLTML

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28410			unknown protein		Lus10022579 [exp]	0	1
AT5G02640			unknown protein		Lus10025282 [exp]	1.0	0.9756
AT5G40020			Pathogenesis-related thaumatin...		Lus10008304 [exp]	1.7	0.9671
AT2G28410			unknown protein		Lus10021476 [exp]	2.0	0.9666
AT2G45300			RNA 3'-terminal phosphate cycl...		Lus10030282 [exp]	6.2	0.9694
AT4G09990			Protein of unknown function (D...		Lus10005822 [exp]	9.8	0.9647
AT5G34850		ATPAP26, PAP26	purple acid phosphatase 26 (.1...		Lus10039978 [exp]	10.4	0.9361
AT4G33330		PGSIP3, GUX2	glucuronic acid substitution o...		Lus10021731 [exp]	10.5	0.9576
AT4G11950			Protein of unknown function (D...		Lus10014138 [exp]	11.0	0.9547
AT3G62020		GLP10	germin-like protein 10 (.1.2)		Lus10038014 [exp]	11.2	0.9661
AT2G28315			Nucleotide/sugar transporter f...		Lus10021464 [exp]	12.0	0.9617

Compare expression of checked genes

Lus10022579 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.