Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G28430 69 / 6e-17 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021477 [exp] 131 / 1e-41 AT2G28430 100 / 3e-29 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G210800 [exp] 88 / 1e-24 AT2G28430 70 / 2e-17 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022580 pacid=23178675 polypeptide=Lus10022580 locus=Lus10022580.g ID=Lus10022580.BGIv1.0 annot-version=v1.0 ATGCTCAGCATTCTCGCTCAAGAGCGCGTGCTCGGATTCGCATTGGGTGGCGCCTTCACTGGTTTTGTGGTCTTCGAGCAGCGGAGACGCATCCGTCAGT CCGTCTCTACTTACCAATCTCCCTCAGATGCACATAATCAGCTGAAAGAGCCGATATTCGGGAAGCAATTTCGTTCGGAGTTTGCTCTTATGTGGAACAA AGCTGTGGACCAGGCTTTCGGACCACTGGTTTCTTCCCTTAGTTCACACAGAGATTAA
AA sequence Show only first row Show all	>Lus10022580 pacid=23178675 polypeptide=Lus10022580 locus=Lus10022580.g ID=Lus10022580.BGIv1.0 annot-version=v1.0 MLSILAQERVLGFALGGAFTGFVVFEQRRRIRQSVSTYQSPSDAHNQLKEPIFGKQFRSEFALMWNKAVDQAFGPLVSSLSSHRD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28430			unknown protein		Lus10022580 [exp]	0	1
AT1G77350			unknown protein		Lus10018864 [exp]	1.7	0.8263
AT2G44620		MTACP1, MTACP-1	mitochondrial acyl carrier pro...		Lus10043348 [exp]	3.5	0.8253
AT2G44525			Protein of unknown function (D...		Lus10012187 [exp]	7.9	0.7193
AT4G14455		ATBS14B ,ATBET1...	ARABIDOPSIS THALIANA BET1P/SFT...		Lus10041158 [exp]	10.6	0.7910
AT2G28720			Histone superfamily protein (....		Lus10017456 [exp]	10.8	0.7768
AT3G04780			Protein of unknown function (D...		Lus10001780 [exp]	10.8	0.8068
AT2G02880			mucin-related (.1)		Lus10012838 [exp]	11.5	0.7943
AT2G44620		MTACP1, MTACP-1	mitochondrial acyl carrier pro...		Lus10019500 [exp]	12.4	0.7689
AT5G55630		ATTPK1, ATKCO1	TWO PORE K CHANNEL 1, TWO PORE...		Lus10000044 [exp]	14.0	0.7738
AT1G32210		ATDAD1	DEFENDER AGAINST APOPTOTIC DEA...		Lus10010413 [exp]	15.5	0.7791

Compare expression of checked genes

Lus10022580 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.