Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52240 113 / 4e-34 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT3G16120 108 / 3e-32 Dynein light chain type 1 family protein (.1) AT4G27360 92 / 2e-25 Dynein light chain type 1 family protein (.1) AT1G23220 80 / 2e-20 Dynein light chain type 1 family protein (.1) AT4G15930 77 / 2e-19 Dynein light chain type 1 family protein (.1) AT5G20110 74 / 2e-17 Dynein light chain type 1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021496 [exp] 219 / 8e-76 AT1G52240 114 / 2e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10011443 [exp] 116 / 2e-35 AT1G52240 164 / 2e-54 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10025794 [exp] 112 / 2e-33 AT1G52240 172 / 1e-57 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10035868 [exp] 110 / 7e-33 AT1G52240 174 / 2e-58 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10037551 [exp] 106 / 5e-31 AT1G52240 157 / 2e-51 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10038566 [exp] 94 / 4e-26 AT4G27360 157 / 5e-51 Dynein light chain type 1 family protein (.1) Lus10034609 [exp] 75 / 2e-18 AT1G23220 181 / 4e-60 Dynein light chain type 1 family protein (.1) Lus10021793 [exp] 71 / 1e-16 AT1G23220 176 / 6e-58 Dynein light chain type 1 family protein (.1) Lus10014484 [exp] 68 / 4e-15 AT5G20110 191 / 2e-61 Dynein light chain type 1 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G091800 [exp] 188 / 1e-63 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.003G052800 [exp] 110 / 8e-33 AT1G52240 151 / 3e-49 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.011G126400 [exp] 107 / 3e-31 AT4G27360 117 / 2e-35 Dynein light chain type 1 family protein (.1) Potri.001G407900 [exp] 103 / 6e-30 AT4G27360 126 / 5e-39 Dynein light chain type 1 family protein (.1) Potri.004G034000 [exp] 94 / 3e-26 AT4G27360 143 / 6e-46 Dynein light chain type 1 family protein (.1) Potri.011G120400 [exp] 82 / 8e-21 AT1G23220 112 / 1e-32 Dynein light chain type 1 family protein (.1) Potri.001G124700 [exp] 75 / 3e-18 AT5G20110 116 / 3e-33 Dynein light chain type 1 family protein (.1) Potri.001G401400 [exp] 75 / 5e-18 AT1G23220 109 / 2e-31 Dynein light chain type 1 family protein (.1) Potri.010G108700 [exp] 74 / 6e-18 AT1G23220 187 / 2e-62 Dynein light chain type 1 family protein (.1) Potri.008G219900 [exp] 73 / 6e-18 AT4G15930 154 / 1e-49 Dynein light chain type 1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01221 [flax] [poplar] Dynein_light Dynein light chain type 1
Representative CDS sequence Show only first row Show all	>Lus10022596 pacid=23178632 polypeptide=Lus10022596 locus=Lus10022596.g ID=Lus10022596.BGIv1.0 annot-version=v1.0 ATGTTGGAAGGGAAAGCTGTGGTGAGAGAGACAGACATGCCAGAAGAGATGCAAAGCCGGGTCCTGGAACTGGCTTACCAGTCTCTTGATCTCCATGAGG TCTCTGACTGTCAATCCATTTCTCATTACATCAAACAGAAATTTGATGAAGCTTATGGAGCAGCATGGCACTGTGTGGTTGGGAAGGATTTCGGCTCATG CATCACTCACCTACGCGGAACTTTTATCTTCTTCAGAGTCGAGATGTTGGAGTTTCTCATCTTCAAGGATGGCAATGACTATAGCCTCACCAAAGAAGAA GCTGTTCGGGTGCTGCAAAGCCATTAA
AA sequence Show only first row Show all	>Lus10022596 pacid=23178632 polypeptide=Lus10022596 locus=Lus10022596.g ID=Lus10022596.BGIv1.0 annot-version=v1.0 MLEGKAVVRETDMPEEMQSRVLELAYQSLDLHEVSDCQSISHYIKQKFDEAYGAAWHCVVGKDFGSCITHLRGTFIFFRVEMLEFLIFKDGNDYSLTKEE AVRVLQSH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G52240		PIRF1, ATROPGEF...	phytochrome interacting RopGEF...		Lus10022596 [exp]	0	1
AT1G27520			Glycosyl hydrolase family 47 p...		Lus10004233 [exp]	1.4	0.9364
AT3G44020			thylakoid lumenal P17.1 protei...		Lus10019382 [exp]	1.7	0.9536
AT3G45400			exostosin family protein (.1)		Lus10020308 [exp]	6.4	0.8364
AT5G23210		SCPL34	serine carboxypeptidase-like 3...		Lus10010190 [exp]	7.1	0.8741
AT1G32220			NAD(P)-binding Rossmann-fold s...		Lus10012126 [exp]	7.2	0.9103
AT1G52240		PIRF1, ATROPGEF...	phytochrome interacting RopGEF...		Lus10021496 [exp]	7.3	0.9198
AT1G70520		ASG6, CRK2	ALTERED SEED GERMINATION 6, cy...		Lus10009703 [exp]	7.4	0.8671
AT5G48930		HCT	hydroxycinnamoyl-CoA shikimate...		Lus10026123 [exp]	10.4	0.8394
AT5G59400			unknown protein		Lus10016531 [exp]	10.6	0.8580
AT1G13820			alpha/beta-Hydrolases superfam...		Lus10037072 [exp]	11.3	0.8797

Compare expression of checked genes

Lus10022596 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.