Lus10022598 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035139 84 / 6e-21 AT2G16676 41 / 1e-04 unknown protein
Lus10020135 60 / 2e-11 ND /
Lus10014248 50 / 1e-07 ND /
Lus10016642 48 / 1e-07 ND 38 / 8e-04
Lus10019378 42 / 4e-05 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10022598 pacid=23178608 polypeptide=Lus10022598 locus=Lus10022598.g ID=Lus10022598.BGIv1.0 annot-version=v1.0
ATGGAAGCCGCCGTCGCCAGACAAGTTTCGCTTGCTGCAATCGATGAAACTATGGGTTCGGTTGGAGTGAGTTCCGGATGGAGTACACTCCTCTGCCTTT
GTTTCTGGGTTGTTGGGTTCGATCGGGGAGGTCTTGGTCGCCGTCAGGCTCGATCGGAGGACGGAATGGAGTTCAGGGTCCGATTGCGGTATGAATGGTT
GCCAGTGGTCTGCTTCAGCTGTGGGCGTCTAGGACACCCTCATACGCGCTGCTCGGCCGGTGGTCTTCCTCCCTTGGATCTTGATGCGCGTGCGCCATGG
ATTACTCTGCGAATCGACACTTATCGAAGAGTCAATGAGTTCACCATGCAACCGGAATCTGGGACTGTTGCGCCGCTGTTGCTTCCTCGACATACGGCGG
AGCAGGGACATAAGCTCTGTTGGTTCTTCCTCGGTGCGGCCGCCGACTAA
AA sequence
>Lus10022598 pacid=23178608 polypeptide=Lus10022598 locus=Lus10022598.g ID=Lus10022598.BGIv1.0 annot-version=v1.0
MEAAVARQVSLAAIDETMGSVGVSSGWSTLLCLCFWVVGFDRGGLGRRQARSEDGMEFRVRLRYEWLPVVCFSCGRLGHPHTRCSAGGLPPLDLDARAPW
ITLRIDTYRRVNEFTMQPESGTVAPLLLPRHTAEQGHKLCWFFLGAAAD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10022598 0 1
AT1G71040 LPR2 Low Phosphate Root2, Cupredoxi... Lus10032443 1.0 0.9308
AT2G39450 ATMTP11 Cation efflux family protein (... Lus10040318 1.7 0.9226
AT4G03230 S-locus lectin protein kinase ... Lus10031592 2.0 0.9209
AT5G49690 UDP-Glycosyltransferase superf... Lus10008955 2.6 0.9068
AT1G28280 VQ motif-containing protein (.... Lus10041929 3.5 0.9230
AT3G54700 PHT1;7 phosphate transporter 1;7 (.1) Lus10033886 5.1 0.8918
AT1G22710 SUT1, ATSUC2, S... SUCROSE TRANSPORTER 1, ARABIDO... Lus10007702 5.5 0.9086
AT5G37660 PDLP7 plasmodesmata-located protein ... Lus10020814 7.1 0.9161
AT1G12940 ATNRT2.5 nitrate transporter2.5 (.1) Lus10013042 7.7 0.8948
AT1G48480 RKL1 receptor-like kinase 1 (.1) Lus10031350 8.5 0.9033

Lus10022598 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.